KEGG   Runella slithyformis: Runsl_5287
Entry
Runsl_5287        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF736
Other DBs
NCBI-ProteinID: AEI51584
Position
6146120..6146326
AA seq 68 aa
MTAENQTTAKFPTHTVYYLKNKEGSEKPDWIKAGASWENSGRKGLNLSLTVLGQPISVVV
CKNKPRET
NT seq 207 nt   +upstreamnt  +downstreamnt
atgactgctgaaaatcaaaccactgcaaaatttcccacccacacggtttattacctgaaa
aacaaagaaggcagcgaaaagcctgactggatcaaagcaggtgcttcctgggaaaacagt
ggccgaaaaggcctgaacctttcccttactgttctgggccaaccgatttctgtcgttgtt
tgtaagaacaagccaagggaaacctaa

DBGET integrated database retrieval system