KEGG   Runella slithyformis: Runsl_5288
Entry
Runsl_5288        CDS       T01553                                 

Definition
(GenBank) AAA ATPase
  KO
K07133  uncharacterized protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Runsl_5288
SSDB
Motif
Pfam: AAA_14 DUF4143 AAA_24 AAA_16 AAA_5 AAA RNA_helicase AAA_18
Other DBs
NCBI-ProteinID: AEI51585
Position
6146451..6147626
AA seq 391 aa
MIIRKATLEIAQLLEEFPAVGVLGPRQVGKTTLAEELAAAMRPQPVYLDLESPKDRAKLS
EPEDYFELHQHQLVILDEIQRMPELFSILRGVIDRRRRQGRKAGQFLILGSASLDLLKQS
SESLAGRIAYKELSGFNVSEIAATAATREQLWLRGGFPDSFLAKSDAGSLRWRLNFINTY
LERDVPQFGPRIPAVTLRRLWTMLAHSQGGQLNTAQLGANLDIAAPTAKRYIELLEDLLL
IRTLRPWSGNIGKRLVRAPKVYIRDSGLTHALLNLTTLDDVLGHPVVGASWEGFVMENLL
SVLPSGMTPWFYRTAAGAEIGLVIEKNSQQRYAIEIKRSQAPSVSKGFYLGCEDIEAAKR
FVIYPGTEKFPILKNVTAVSLPDMMDEMQRW
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgattatacgtaaagccaccttagaaatagcgcagttgctggaagaatttcccgccgtc
ggcgttttgggcccccgtcaggtgggcaaaacgaccttggccgaggagttggcggcggcc
atgcgcccgcagcccgtttaccttgatttggaaagccccaaagatcgggcaaagttaagt
gaacccgaagattattttgaactgcatcaacaccagctcgtcattttagatgagatccaa
cggatgccggagttattttctatcctccggggggtgatcgaccgtcggcgcaggcagggc
cggaaagcagggcagtttttaattttaggttccgcctctctggatttgctgaaacagtcc
tcggagtcactcgccggacgaattgcctataaggaactttccggttttaacgtttcggaa
atcgcagctacagctgccacccgcgagcagttgtggctgcggggcggtttccccgacagt
tttctggcaaaaagtgacgccggcagcctgagatggcgtctcaattttatcaatacctat
ctggaacgggatgtaccgcaattcgggccgcgtattccggccgttacgttacggcgatta
tggacgatgttggcccacagtcagggagggcagttgaacacagcacagctgggggccaat
ctggacattgctgcgccgaccgccaaacgctatattgaattgctggaagatttattgctg
atccgcaccctccgcccgtggtcgggtaatatcggaaaacggctggtcagagcacccaaa
gtctacattcgtgacagcggattgacccatgcgctgcttaacctgacaacccttgatgat
gtgcttgggcatcccgtcgtcggagcgagttgggaaggtttcgtcatggaaaacctgtta
tcggtactgccttcgggaatgacgccgtggttttatcgcacggctgcgggggcagaaatt
ggtttggtgatcgagaaaaacagccaacagcgctacgccatcgaaataaaacgctctcag
gctccgtcggtttccaaaggattttatttggggtgcgaagacatagaggctgccaagcgg
tttgtcatttatccgggcacggaaaaatttccgattttgaaaaacgtcacggccgtttcg
ttgccggatatgatggatgaaatgcagcggtggtaa

DBGET integrated database retrieval system