KEGG   Runella slithyformis: Runsl_5289
Entry
Runsl_5289        CDS       T01553                                 

Definition
(GenBank) transposase IS204/IS1001/IS1096/IS1165 family protein
  KO
K07485  transposase
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Runsl_5289
SSDB
Motif
Pfam: DDE_Tnp_ISL3 FANCI_S1-cap
Other DBs
NCBI-ProteinID: AEI51586
Position
complement(6147934..6148917)
AA seq 327 aa
MDTNPNSTNSIGEFYGVKGRNLLRHYKDCQGGFKHWNQKSNAKLWLLYPQNMGTHLSIDE
TSLSDGELYTILTNKAAKGRKGSIVAIIAGTKAETVIEILRRIPVRPRKKVLEITLDMAG
NMALIAKRCFPLATQVTDRFHVQKLASEALQEIRIKYRWQAIDAENEAIEQAKISQQPYH
AEVLANGDTLKQLLARSRYVLYKKEKDWTENQKQRATLLFERYPDLKKAYELTMALSHIF
ENTTDKLYGLARLAKWHEKVRQSGFKAFNTVARSIQNHYETILNYFDNRSTNASAESFNA
KIKAFRAQFRGVRNVEFFLYRLTQLYA
NT seq 984 nt   +upstreamnt  +downstreamnt
gtggatacgaatccgaatagtacaaattcaatcggagagttttatggcgtgaagggtcgg
aatctgcttcgtcactacaaagattgccaaggtggattcaaacattggaatcaaaagtct
aatgctaaactatggctgttataccctcaaaatatggggactcatctttccattgatgaa
acctcgttatctgatggggagttatacactattcttaccaataaagcagccaaaggcaga
aaagggagcattgtagcaattattgcgggtacaaaggctgaaacagtcattgaaattctt
cgcaggatacctgtaagacctcgtaaaaaagtccttgaaattacgctggacatggccggt
aatatggctttaatcgccaagcgctgtttccctttggctacccaagtcactgaccgtttc
catgtacagaaattggcctccgaagctttacaggaaatcaggatcaagtatcgatggcag
gccatagatgccgaaaatgaagccatagaacaagctaaaatcagtcaacaaccttaccat
gctgaagttctcgctaatggagacacccttaaacaattattagctcgcagcaggtatgtg
ctctacaaaaaggagaaagattggacagagaatcaaaaacaaagggcaacactacttttt
gagcgctatcctgatttgaaaaaagcctatgagttaacgatggccttgagccatattttt
gagaatactactgataaactttatggattggccagactggccaaatggcatgaaaaggtt
cgtcagtcaggatttaaagccttcaacacggtggcgcgttctattcaaaaccattatgaa
accatccttaactattttgataatcgaagtacgaacgcgtctgccgaatcttttaatgcc
aagattaaagcttttcgagctcagttcagaggggtaaggaatgtagaattctttctttat
cggctaacgcagttatatgcttaa

DBGET integrated database retrieval system