KEGG   Runella slithyformis: Runsl_5290
Entry
Runsl_5290        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: zf-ISL3
Other DBs
NCBI-ProteinID: AEI51587
Position
complement(6148898..6149260)
AA seq 120 aa
MESFLPIVQFLLPEFILENFELTTINRQEGVFHIHLTEKNTDDRDSERKNLLSKGFFAPI
TVQDFPLRGQKVFLHIKRRRWLNTQTGKVVYRDWAEVSKGTRMTSEFANFLKGISGYESE
NT seq 363 nt   +upstreamnt  +downstreamnt
ttggagagtttcctacctatcgttcagttcctgttgcccgagttcattttggaaaatttt
gaattgactactattaaccgccaagagggtgtcttccatatccatcttacagagaaaaat
acagacgatcgagactctgagcggaaaaatttgttatccaaaggtttttttgcgcccata
actgtccaagactttcccctgcgtgggcaaaaggtctttcttcacattaagcgccgccga
tggctcaatacccaaacaggtaaagtagtttacagagactgggcagaagtaagcaaagga
acgcgaatgacaagtgaattcgcgaattttttaaaaggtatcagtggatacgaatccgaa
tag

DBGET integrated database retrieval system