KEGG   Runella slithyformis: Runsl_5292
Entry
Runsl_5292        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF3142
Other DBs
NCBI-ProteinID: AEI51589
Position
complement(6152037..6154529)
AA seq 830 aa
MKTVALILLYLSLPLLLFWWGWFAWWVALPSTLALLYFFFAFWQTYAVSLRFSLPHKALI
PLWSCLLLALVWTYLAGVGGFRPQHFDYYKHNLIFNNLIRHGPPVRYADGSYLCYSLAYY
LPPAWVARWTGGLPYVHYVIFGWTWLGLGLVFTLLSRLNGWKMILLFLFFNSPEAILYIY
DAAKAPDFLLFLKDLWSTDHTIELLQSPGGLLFHSHVESFIATPQHALSAWLATGILLTV
WKNSAARPFVILPFALVALLLYWSPFVAVGLLPLALYVFWDQKTPLPFSIPHVLRTLVFV
VLLTFPVLIFYAGHVPVTSANGGWWNFLKTPKDVVFLVIFVGLEIGIWGFFIGNAFKNRD
LPKRDLGLLLCALLTLLAAALYRYGPLNDFARRASLPAMLVICWGISTLSFRKPMLMVTL
MLCVLLPLKQQLRWFSARPYTPIVNKTIPSFTPYPIHYLGHFHRASFDAATQYLGRADAW
YLRYFAPDGPPKPKEVTRAFYYWKSTFQLTDYEKHALQRYAVTRLYVKFFDVDWDMATRR
AVPKAAIHFAETPTVEMIPTVFITNRTLEKLSWGGVDELAGKIVAKIDNLTPAPLLKKGE
GESEVQIDCDWSLATRAKYFRLLNQLKKKLPDGTRLSATIRLHQIKFYRTTGVPPVERGM
LMYYNMDDWKNPKTENSILDLTVAGRYADYVSDYPLPLDLVLPVFRWAVVYRNGRFLRFV
NHLTHQQLSTHSLFQKSTLPNAYIVRQNGTFVGIPVRRGDLFRVEESTVENLKISTQTLA
QEIQNTKATFALYHLDSLNLTYYAVPNARVFLPERKEVDDPIQQIFQTFR
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgaaaaccgtcgccctgatattactgtatctttccctgcctttattgcttttttggtgg
ggctggtttgcgtggtgggtagccctgccgtccacgctggcattgctctatttcttcttt
gctttttggcaaacctatgctgtctcactgcgattctctttaccccataaagcgctgata
ccgttatggagctgcctgcttttggccttggtatggacatacctcgcgggggtgggcggt
tttcggccgcagcattttgattattacaaacacaacctgatcttcaataacctgatccgc
catggcccgcccgtacgttacgccgacggctcttatctgtgctattctctcgcttattac
ctgccgccggcgtgggtagcgcgttggacgggtggcctaccatacgtgcattatgttatt
ttcggctggacatggctcggactggggctcgtatttacccttctttctcgcctgaacgga
tggaaaatgatcttgctgtttttgttcttcaacagccccgaagccattttgtacatttat
gacgccgccaaagcacctgattttctgcttttcctgaaagatctttggtccactgaccat
accatcgaactccttcaatcgccgggaggattattgtttcacagccacgtagagtcgttt
attgccacgccccagcatgccctttcggcgtggttggctacgggtattttgttgacggtt
tggaagaactctgccgcccgcccgttcgttattttgccttttgctttagtcgctctgctg
ctctactggtcacctttcgtggcagtcggtcttttgccgttagccctttatgtgttttgg
gatcaaaaaacgcccttaccgttttccattcctcacgttctccgtacattggttttcgtc
gttcttttgaccttcccggtacttattttttacgccggtcacgtcccggtgacttctgcc
aacggtgggtggtggaatttcctgaaaacgcccaaagacgtcgtttttttagtcattttt
gtcgggttggagatcggtatttggggcttttttatcggcaatgcattcaaaaaccgcgac
cttcccaaacgggaccttggccttctgctttgcgcacttcttaccctgttggccgcagca
ctgtaccgttacggtccgctcaatgactttgcccgacgggcgagcctgccggcaatgttg
gtgatctgttggggcatcagtacgctctctttcagaaagcctatgcttatggtgacgctg
atgctgtgcgttctgttgcccctcaaacagcagcttcgatggttcagcgcacggccttac
acaccgattgtgaacaaaaccatcccatcctttaccccttatcctatccattatttgggt
cattttcaccgcgcttcgttcgacgcggccacccagtacctggggcgggccgatgcgtgg
tatctacggtattttgcccccgatggtccgccgaaacccaaagaagtcacgcgggctttt
tattattggaagtctacgtttcagctcaccgactacgaaaaacacgccctccaacggtat
gctgtgacacgactgtatgtcaaattttttgacgtagattgggatatggctacgcgccgg
gccgtacccaaagcagcgattcattttgccgaaactccgacggtggagatgatccccacg
gtgttcattaccaatcgcacgctggaaaaactgtcgtggggaggagtcgatgaactggcg
ggaaagatcgttgccaaaatcgataacctaacacctgcccctctcctaaaaaaaggagag
ggggaatcggaagtgcagatagattgtgactggtcattggcaacgcgggcaaaatatttc
cgattgttgaaccaattgaagaaaaaactgcccgacgggacgcggctttcggccaccatt
cggttacaccagatcaagttttaccgcacgaccggggtacctcccgtggagcgcggaatg
ctcatgtattataacatggacgattggaaaaatcccaaaaccgaaaactccattctggac
ctgaccgtggcgggccgctacgccgattatgtatcggactatcccctgccgctggacctg
gtgctgccggtatttcgctgggcggtggtgtaccgcaacgggcggtttctgcgattcgtg
aatcacctcacccatcagcagttaagcacgcactccctttttcaaaaatccacccttccc
aatgcgtacatcgtacggcaaaacggcacatttgtcggcattcccgtacggcgcggcgac
ctgtttcgggtggaggaaagcaccgttgaaaacctcaaaataagcacccaaaccttagca
caggaaattcaaaatacaaaagctacctttgcgttatatcacctggattccctaaatctt
acgtactatgccgttccgaatgcccgcgttttcctccccgaaaggaaagaagttgacgac
ccgattcaacagatttttcaaaccttccgctaa

DBGET integrated database retrieval system