KEGG   Runella slithyformis: Runsl_5293
Entry
Runsl_5293        CDS       T01553                                 

Definition
(GenBank) Cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
rsi  Runella slithyformis
Pathway
rsi00730  Thiamine metabolism
rsi01100  Metabolic pathways
rsi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Runsl_5293
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Runsl_5293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsi03016]
    Runsl_5293
   03029 Mitochondrial biogenesis [BR:rsi03029]
    Runsl_5293
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rsi02048]
    Runsl_5293
Enzymes [BR:rsi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Runsl_5293
Transfer RNA biogenesis [BR:rsi03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    Runsl_5293
 Prokaryotic type
    Runsl_5293
Mitochondrial biogenesis [BR:rsi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Runsl_5293
Prokaryotic defense system [BR:rsi02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Runsl_5293
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2
Other DBs
NCBI-ProteinID: AEI51590
Position
6154643..6155794
AA seq 383 aa
MRLPVYLDYNATTPVDSRVLEAMLPWFSEHFGNAASRTHLYGWTAEEAVATARKQVAKLL
KTNLKEVVFTSGATEANNLAIKGVFEKYSYKGKHIVTVATEHKAVLDTCHHCEQLGGEVT
YLRPDTNGLITPQQVAEALRSDTILVSVMYANNEIGVIQPIREIAAATHAGGALFHTDAT
QAAGKLPIDMAEEGIDLLSLSAHKFYGPKGVGALAVRQGVELTAQLDGGGHERGRRSGTL
NVPGIVGLGKACELAQKEMNAEAERLCRLRDRLEQEILANVPHTFVNGKASQRLAHLTNI
CFEHIDGENLLLSLKDIAVSTGSACTSASVLPSYVLKILGLTDDQAYASLRFSLGRFTTE
EEIECTIQHVIETVERMRVGSAV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcgactgcccgtttatttggattacaatgccacgacacccgttgactcgcgggtattg
gaagccatgttgccgtggtttagtgagcacttcggcaacgccgccagccgcacgcatctc
tacggctggaccgccgaagaagcggtggcaacggcccgtaaacaggtggctaaactgctg
aagaccaacctgaaagaagtagtgtttacgagcggagccaccgaggctaacaatttggct
atcaagggcgtttttgagaaatattcatacaaaggaaaacacatcgttacggtcgccacg
gaacacaaggcggtcttggatacctgtcatcattgtgagcaattgggcggtgaagtcacg
tatttgcggcccgataccaacggactcatcaccccgcagcaggtggccgaggcattgcgg
tccgatacgattctggtgtcggttatgtacgccaacaacgagattggagtcattcaaccc
attcgggaaattgcggccgctacgcacgcaggcggggcgctgtttcataccgatgccacg
caggccgccggaaaattgccgattgatatggccgaagaaggcattgacctgctgagtttg
tcggcgcataaattttacggtcctaagggcgtcggtgcgttggcggtgcggcagggcgtt
gagctgaccgcccaattggacggcggagggcatgagcgcggccgccgttcgggaacgctc
aacgtgccgggaattgtgggtttgggaaaagcctgtgaactggctcaaaaagaaatgaat
gccgaagccgagcgtttatgccggttgcgtgaccgtctggaacaggaaattttagccaac
gtgccgcatacgtttgtcaatggaaaagcctcgcagcggttagcgcatttgaccaatatt
tgttttgaacacatagatggcgaaaatctgttgctgagtctcaaagacattgccgtctcg
acgggttcggcctgtacttctgcgtcggtattaccatcctatgttctgaagattctcggg
cttaccgacgatcaggcgtatgcttcgctgcgcttcagtttggggcgttttaccaccgaa
gaagaaattgaatgcacgattcagcacgtaatagaaaccgtagaacggatgcgcgtcggc
agtgcggtttga

DBGET integrated database retrieval system