KEGG   Runella slithyformis: Runsl_5295
Entry
Runsl_5295        CDS       T01553                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-related FMN-binding protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Pyrid_ox_like Putative_PNPOx Pyridox_ox_2 Pyrid_oxidase_2 DUF503
Other DBs
NCBI-ProteinID: AEI51592
Position
6156540..6157040
AA seq 166 aa
MENSKGSPKTRKDFKEMVKDIRIAMLCTITSEGYIHSRPMGTSDVDEEGNIWFFTSESSQ
KINEVEDNSNVSVCYADPDDNTYVCVMGTAQIVHDRKKIDELWNPALKIWFPEGKEDPEI
VLIKIDPISAEYWDSSSSKMVVLFNMAKALVTGKEYDEGEYGKINL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggaaaattcaaaaggctctcctaaaacaaggaaagattttaaagaaatggtaaaagac
attcgcattgcaatgctttgcaccattacatccgaaggatacattcacagtcgcccgatg
ggtacatccgatgtggatgaggaaggaaatatttggttctttacgagcgaatcctcgcaa
aagatcaatgaagtggaagataattcaaacgtaagtgtgtgttatgccgacccggatgat
aacacctacgtgtgtgtgatgggaacggctcaaatcgtacacgatcgcaaaaagatagat
gaactttggaatcccgcgttgaaaatatggtttcccgaaggaaaagaagatcctgaaata
gtgttgatcaaaatagacccgatctcggcggaatactgggatagttcttccagcaaaatg
gtggttttgttcaacatggccaaagccctcgtaacgggcaaggaatacgatgagggcgaa
tacggaaagatcaatttatag

DBGET integrated database retrieval system