KEGG   Runella slithyformis: Runsl_5296
Entry
Runsl_5296        CDS       T01553                                 

Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
rsi  Runella slithyformis
Pathway
rsi00270  Cysteine and methionine metabolism
rsi00450  Selenocompound metabolism
rsi00670  One carbon pool by folate
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01230  Biosynthesis of amino acids
Module
rsi_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Runsl_5296
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Runsl_5296
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Runsl_5296
Enzymes [BR:rsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Runsl_5296
SSDB
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding Urocanase_C
Other DBs
NCBI-ProteinID: AEI51593
Position
complement(6157104..6161006)
AA seq 1300 aa
MQNPNIQEILKSRILVLDGAMGSMIQRYTLADADYRGERFKDFPHELKGNNDLLSLTRPD
VIREIHEAYLEAGADIIETNTFSGTTIAMADYHMEDLVYELNYESARLAREACDKYAALN
PDKPRFVAGSIGPTNRTASLSPDVNDPGFRAVTFDELVDAYYEQVQALTDGGADVMLVET
IFDTLNAKAALYAIDLYFDDVKKGTVRPIRGAFRPASVNTTKIQLPIMVSGTITDASGRT
LSGQTTEAFLTSVSHMPLLSIGLNCALGADLMRPYVQTLATQAPFYTSAHPNAGLPNEMG
EYDQTPEQMAVIIDDFLQNGFINIIGGCCGTTPPHIKAIAEVAAKYEPRDIPENDHVQKL
SGLEPLKITKETNFVNIGERCNVTGSKKFARLIREGNYDAAIAVAREQVDTGAQVIDINM
DEGMIDGVQAMTKFCNLLMAEPDIARVPFMVDSSKWEVIEAGLKCLQGKAIVNSISLKEG
EEKFIQQAEKVRRYGASVVVMAFDEVGQADNYERRLEICERAYWILVNKVGFPPQDIIFD
PNILTVGTGMEEHNNYAVDFINATRWIKEHLPYAKVSGGVSNVSFSFRGNEPVREAIHTV
FLYHAIKAGMDMGIVNAGQLGVYDDLPKDMLEHCEDLILNRRPDATERMLAFAETVKSKG
KEQVIDTAWRDQPVAKRLEHALIKGLTEYIDQDVEEARQTVDKPLHVIEGPLMDGMNVVG
DLFGEGKMFLPQVVKSARVMKKAVAYLLPFIEEEKNASPSTTESGGSKILLATVKGDVHD
IGKNIVGVVLACNNYEIIDLGVMVPTDKILAAAKEHNVDIIGLSGLITPSLDEMVGVAKE
MERQGFKVPLLIGGATTSRIHTAVKIDPHYSGPVIHVLDASRAVPVAGKLTQNEQTYAEA
LADIKKEYAKLREDHAKRQQAKEAVTIEAARANKTKIDWETFTPVKPAFLGNRYFYDYPL
EEIAKYIDWTPFFQTWQLHGKYPKIFDDAVVGNEAKKLYNDAKAMLAEIIQNKSLKANAV
IGFYPANSVGDDIVLHDFEEVEVRFAGQGQKKRTEYRVVLSSGASEVGTSQKTETDFQSA
QTVLHHLRQQNQKAANLPNLCLSDYIMPLSGDKPEAINDGITNPAEPLRTDYIGAFAVTA
GIGIEALLEKYEADHDDYNSIMVKAVADRLAEAFTELMHERVRKEYWGYVKDEALSNEEL
ISEKYQGIRPAPGYPACPEHTEKRTLFDLLDAEAQIGIQLTESFAMYPASSVSGWYFAHP
DSRYFALGKIAKDQVQDYAARKGMTLEEAEKWLSPVLNYD
NT seq 3903 nt   +upstreamnt  +downstreamnt
atgcagaacccaaacatccaggaaatcctcaaatcccgtatcctcgtgctcgacggtgcg
atgggctcgatgatccaacgttatacattagccgacgccgattaccggggcgaacgtttt
aaagacttcccgcacgagctcaaaggcaacaatgacctgctgtcgttgacacgccctgac
gtgattcgggaaatccacgaagcctacctcgaagccggtgcggacatcatcgaaaccaac
accttcagcggtaccaccatcgccatggccgactaccacatggaggatctggtctacgaa
ctcaattacgaatcggcgcggctggcgcgggaagcctgcgataaatatgccgccctgaat
cccgacaaaccccgttttgtggcgggttccattggccctaccaaccgcacggcctctctc
tctcccgacgtaaacgaccccggtttccgcgccgttacgtttgacgaactcgtcgatgcc
tattacgaacaggtacaggccctgaccgacggcggggcggatgtgatgctggtcgaaacc
atctttgatacgctcaacgccaaagcagccctgtacgccattgacctgtactttgacgac
gtaaaaaaaggcactgttcgccccattcgcggtgcgttccggccggcatcggtcaatacg
actaaaatccaattgcccatcatggtatcaggtaccattacggatgcttccggacgcacc
ctttcgggccaaaccactgaagcctttctgacctcggtatcgcacatgcccctgctttcc
attgggctgaactgtgcgctgggcgcagatctgatgcgtccttatgtacagacgctggct
actcaggcacccttttatacctccgcgcaccccaatgcaggcctgcccaacgagatgggt
gaatatgaccaaacgccggaacaaatggccgtcatcattgacgactttctgcaaaacggg
ttcatcaatatcatcggcggttgctgcggcaccacgccgccgcacatcaaggccattgcc
gaagtagccgcaaaatacgaaccgcgcgatattcccgaaaatgaccacgtgcagaaactg
tcgggtctggaaccgctcaagatcacgaaagagaccaatttcgtaaacatcggagagcgc
tgtaacgtaacgggttcgaagaaatttgcccgtttgatacgcgaaggaaattacgacgcc
gccattgccgtggcgcgcgaacaggttgataccggtgcgcaggtgatcgacatcaacatg
gatgaaggaatgatcgatggggtgcaggccatgaccaaattctgtaacctgctcatggct
gagcccgacattgcccgcgtgccgttcatggtcgactcctcgaaatgggaagtgatcgaa
gcagggttgaaatgtttgcaggggaaagccattgtcaattctatctcactcaaagaaggc
gaagaaaaattcattcagcaggccgaaaaagtccgccgctacggggcgtcggtggttgtc
atggcttttgacgaagtgggtcaggccgacaactacgaacgccgtctggaaatctgcgaa
cgggcctattggatcttggttaacaaagtaggattccctccgcaggacatcatttttgac
cctaacatcctgaccgtaggtacggggatggaagaacataacaactatgcggtagacttc
atcaacgcgacccgctggatcaaggaacacctgccctacgctaaagtcagcggtggggtt
tccaatgtatcgttctcattcagaggcaatgagcccgttcgcgaagccattcataccgta
tttttgtaccatgccatcaaggcaggtatggacatgggcatcgtgaatgcgggccaactg
ggcgtgtacgacgacctgcccaaagacatgctcgaacactgcgaagacctcatcctgaac
cgtcgcccggacgccaccgagcggatgctggcctttgccgaaaccgttaaatccaaagga
aaagaacaggtcattgatacggcatggcgcgaccaacccgtggccaaacgcctcgaacac
gcgctcatcaaaggattgaccgaatacattgaccaagacgtagaagaagcccgccaaacg
gtcgacaagccgttgcacgtcatcgaaggtccgcttatggacggcatgaacgtggtgggg
gatctgttcggcgaaggaaaaatgtttttaccccaagtggtaaaatcagcacgggtcatg
aagaaggccgtagcctatctgttgccgtttatcgaggaagaaaagaacgcctccccgtca
acgacagagtcagggggctccaaaatcctcctggccacggtcaaaggcgacgtacacgac
atcgggaaaaacatcgtaggggtagtattggcctgtaataattatgagatcatcgacctc
ggcgtgatggtgccgactgataagatattggccgccgccaaagaacacaacgtagacatc
atcggactttcgggcctgatcacgccttcgctcgacgaaatggtgggcgtggccaaggaa
atggaacgtcagggctttaaagtaccgttgctgatcggcggtgccactacctcgcgtatt
cacacggccgtcaagatagatccgcattacagcggtcctgtcattcacgtattggatgcc
agccgggccgtgcccgtggcaggaaagctgacccaaaacgagcagacctatgccgaagcc
ctcgccgacatcaaaaaagaatacgccaaactccgcgaagaccacgccaaacgtcagcag
gccaaagaagccgtcacgatcgaagcagcgcgcgccaataaaaccaagatcgattgggaa
acctttacgccggttaaacctgcgtttttgggcaacaggtacttctacgattatccgctg
gaagagattgccaaatacatcgactggacgcctttcttccaaacctggcagttacacggc
aaataccctaaaatatttgacgatgctgtggtaggaaacgaagccaaaaagctctacaac
gacgccaaggccatgttggccgaaattatccaaaataagtcgttgaaagccaacgcggtc
atcgggttttaccccgccaattccgtaggagatgatattgtgctgcacgattttgaagaa
gtggaagtacgttttgccggacagggccaaaagaaacgcaccgaataccgtgttgttctg
tcatcaggcgcttccgaagtcggaacttcgcagaaaacggagaccgattttcaatctgcc
caaaccgtgttgcatcatctgcgccagcaaaaccaaaaagccgccaatttgcccaatctg
tgtctgtcggattatattatgccgctctcgggtgataaacccgaggccataaacgacggg
attacaaatcccgccgagccgctgcggaccgactacatcggcgcctttgccgtcacggca
ggcattggcatagaagctttattggaaaaatacgaagccgatcacgacgattacaacagc
atcatggtcaaagccgtagccgaccgtttggcggaggcgtttacagagctcatgcacgag
cgtgttcgcaaagaatattggggttatgtaaaagacgaggctctttccaacgaagaattg
atttcagaaaaataccaaggaattcgccctgcccccgggtatccggcctgccccgagcac
accgaaaaacgcacgttgtttgacctgcttgacgccgaagcacagatcggtattcagttg
accgagagtttcgccatgtatccggccagttcggtaagcggttggtactttgcgcacccg
gattcacggtattttgccctcggaaaaatcgccaaagatcaggtacaggactacgccgcc
cgcaaaggcatgacgctcgaggaagccgaaaaatggctttcacccgtgttgaattacgac
taa

DBGET integrated database retrieval system