KEGG   Runella slithyformis: Runsl_5298
Entry
Runsl_5298        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: OMP_b-brl
Other DBs
NCBI-ProteinID: AEI51595
Position
complement(6162051..6162527)
AA seq 158 aa
MKKLAIFLLGALPFLTFDSVVAQDYRTGIGLRAGTTNGLTIKHYTKPKVALEGIISSRWR
GLGLTGLIEGHTRAFDVNRLNFYYGAGAHIYFWGESRRGYAPYRDRDSVVGLDGILGLEY
NFREIPINVSLDWKPTFNFNVPDNFWGDDAAISVRYIF
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaaaaagttagccatttttcttttaggtgcccttccgtttttaacgtttgattcggtc
gttgcacaggattacagaacgggtatcgggctccgcgccggaacgaccaacggcctgaca
attaagcactatactaagcccaaagtagcgctggaagggattatctcttcgcggtggcgg
gggttgggactgaccggactgattgaaggccacactcgcgcttttgatgtcaatcgcctg
aatttttactatggtgccggagcgcacatttatttctggggcgaaagcagacggggatat
gctccctaccgcgaccgcgacagcgtagtcggtctggacgggattctgggcttggaatac
aactttcgtgaaatccccatcaacgtcagccttgactggaagcctactttcaattttaac
gttccggataatttttggggagacgatgccgctatatccgttcgctatattttttaa

DBGET integrated database retrieval system