KEGG   Runella slithyformis: Runsl_5299
Entry
Runsl_5299        CDS       T01553                                 

Definition
(GenBank) OmpA/MotB domain protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: OmpA Gly-zipper_Omp Gly-zipper_YMGG Rick_17kDa_Anti TraT DUF1269 Romo1
Other DBs
NCBI-ProteinID: AEI51596
Position
complement(6162590..6163345)
AA seq 251 aa
MKALTSGLIAVYILTQSIFTTETASAQQSTKNKVTASKKAGTSKNTQLKKSQKGALIGVG
TGAVIGGLIGKNNKNTAIGAIIGATVGGAAGAVIGNHMDKQAEKLREDLGSVARVERVGE
GVKLTFDNALLFDFGSFLLRSETQESLRKMAQTLKSDQNTNLTVEGHTDNVGSAQFNKEL
SDKRAQAVSNFLVAEGVSSNRFKVIAQGEAAPIATNTTEVGRQQNRRVEIGLYASDEMKK
AAQNGAVSLKQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaaagcactcacatccggtttgattgcagtgtacattcttacgcagtcgatttttaca
acagagacagcttctgcccaacaatccacgaagaacaaagtaaccgcttccaaaaaagca
ggcacttccaaaaatacccaattaaaaaaatcccaaaaaggagcgttgatcggagttggt
acgggggcggttattggtggccttatcggtaaaaacaataaaaatacggctatcggtgct
attatcggtgccactgtgggcggggcggcgggagcggtcattggtaatcacatggacaaa
caggccgaaaaacttcgggaagacttaggcagtgtggcccgcgtggagcgcgtaggagaa
ggtgtcaaattgacctttgacaatgccctgctttttgatttcggttcatttttgttacgc
agcgaaacgcaggaaagtctgcgaaaaatggcccaaacgctcaaaagtgatcaaaatacc
aatttaacggtggaaggtcatacagataatgtaggctctgcgcaatttaacaaagaactg
tctgacaaacgggctcaggccgtctctaactttctggtggccgaaggggtctcttccaat
cgttttaaagtgattgcacagggcgaagccgcaccgatcgcgaccaacactaccgaggta
ggccgtcagcaaaaccgtcgggtggaaattggcctctatgccagtgatgaaatgaaaaaa
gcggctcaaaacggagccgtcagtttaaagcaataa

DBGET integrated database retrieval system