KEGG   Runella slithyformis: Runsl_5300
Entry
Runsl_5300        CDS       T01553                                 

Definition
(GenBank) transcriptional regulator, AsnC family
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rsi03000]
    Runsl_5300
   03036 Chromosome and associated proteins [BR:rsi03036]
    Runsl_5300
Transcription factors [BR:rsi03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    Runsl_5300
Chromosome and associated proteins [BR:rsi03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Runsl_5300
SSDB
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type HTH_20 TrmB HTH_11 MarR_2 MarR HTH_5 HTH_DeoR GntR HTH_Crp_2 HTH_17 DDRGK HTH_28 DUF1670 HTH_34 Fe_dep_repress HTH_27 AbiEi_4 HTH_IclR ALAD Sigma70_r4 FaeA Rrf2 HTH_29 HTH_10
Other DBs
NCBI-ProteinID: AEI51597
Position
6163647..6164108
AA seq 153 aa
MVKLDMTDRGILRYLQQNALLTTKELAAQLNLSYTPVYERVRKLEREGIIKKYVALVNRE
EIGKNLIAFCNVSLKEHSRANGEKFVSAVMTFDEVMECYNISGEYDFMLKVVVNDMPEYQ
RFLMEKLGALDSIGNTHSIFVMSEIKHETALKV
NT seq 462 nt   +upstreamnt  +downstreamnt
atggtaaaattggatatgaccgaccgaggtattttacgatatcttcaacaaaatgccctt
ttgaccaccaaagaattggccgcacagctgaatctttcgtacacgcccgtctatgaacgc
gtccgaaagttggagcgggaaggcattataaaaaaatacgtggccttggtcaatcgggaa
gagatcggcaaaaacctgatcgccttctgcaacgtttcactcaaagaacacagtcgtgcc
aacggtgaaaagtttgtgtcggccgttatgacctttgatgaagtgatggaatgttataat
atttcgggagaatacgattttatgctcaaagtcgtggtcaatgatatgcccgaataccaa
cggtttttgatggaaaagctgggggcgttggacagcatcggcaatacgcacagcattttc
gtgatgagtgagatcaaacacgaaacggcattgaaagtttag

DBGET integrated database retrieval system