KEGG   Runella slithyformis: Runsl_5301
Entry
Runsl_5301        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51598
Position
6164469..6164741
AA seq 90 aa
MTRCYQYGVLLKVEVSELFIEWHGKGQRGQLPLYSIKSIACAPGVILLYGNNVSVVISIP
QDCASDEMAHELCDCISRIRSGISEDLMVN
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaccagatgttatcaatacggagtattattaaaggtagaggtgagcgaactgtttatt
gaatggcatggtaaaggacagcgcggtcaacttcctctttactccatcaagtccattgcc
tgcgcgccgggcgtcattctgttatacggcaataatgtatccgtggttatttccattccg
caggattgtgcatccgacgagatggcgcatgaactgtgtgactgcatcagtcgaatacgc
tcaggaatttcggaagacctaatggtcaattga

DBGET integrated database retrieval system