KEGG   Runella slithyformis: Runsl_5302
Entry
Runsl_5302        CDS       T01553                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K07137  uncharacterized protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Runsl_5302
SSDB
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 Lycopene_cycl FAD_oxidored
Other DBs
NCBI-ProteinID: AEI51599
Position
6164848..6166443
AA seq 531 aa
MHQTLHLTLPPETALDESAFRQYIIQSLHLQDTDALTVRKLRQSIDARSRQIKVNVQADI
YADELPPSVITYKKEYPDVSQKPIVVIVGCGPAGMFAALRLVELGYKPILLERGKDVRAR
RRDLAAINKDHVVHPDSNYCFGEGGAGTYSDGKLYTRSNKRGDVRRILEIMVAHGAAEEI
LYDAHPHIGTNKLPPLIADMRQSILNAGGEVHFETKVTDFIFSEKSTIDHRQSEIRGVVT
ADGREFTGIGVILATGHSARDIFELCQAKNVLIEAKPFAVGVRIEHSQKLIDSLQYHRPD
RGAYLPAASYSLVTQSQHKNVQRGVFSFCMCPGGFIVPAATSPGELVVNGMSPSRRDSRF
ANSGMVVSIEDVDLKPYAAFGALAGLELQRVIEQKACSLAGGGQTAPAQRVLDFVKGKTS
PELLDTSYQPGLLSMDLREYLPAHIAEPLRQGLQDFGRKMSGYVSNEAQLIGVESRTSSP
VRIPRHRETAEHIYTQRLYPCGEGAGYAGGIMSAALDGTFVAEQLVNRYGK
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcatcagacacttcatctcacgctgccgcccgagacggcattggacgaatcggccttt
cgtcaatacattattcaaagccttcatttgcaggatactgatgccctgaccgtacgtaaa
ctcaggcaatccattgatgcccgttcacgtcagatcaaagtcaacgttcaggcggatatt
tacgccgatgaactgcctccttccgtcatcacgtataaaaaagagtatccggatgtatct
caaaaaccaatagttgttattgttggctgcggtccggcgggcatgtttgcggctttgcga
ttggtggagttgggctataaaccgattttgttggaaaggggaaaagacgtgcgcgcccgg
cggcgagatctggccgccatcaacaaagaccatgtcgtgcatccggattccaattattgc
ttcggagaaggcggggccggtacgtattcagacggaaaattatatacgcgttccaacaaa
cgcggcgacgtgcggcgaattttggaaatcatggtcgcccacggtgcggccgaagaaata
ttatacgatgcccatcctcacatcggcaccaacaaactcccgcccctcatcgccgatatg
cgtcagagcattctcaacgcgggcggggaagtgcattttgaaaccaaagtcacggatttc
attttttctgaaaaatcaaccatcgaccatcgacaatccgaaatcaggggcgtcgttacg
gctgacgggcgtgaatttacgggcataggtgttattttggcaacggggcactccgcccga
gatatttttgaattgtgtcaggccaaaaatgtgctgatcgaagccaaaccttttgccgtt
ggggtgcgcattgaacactcccaaaaactcatcgactccctacaataccatcgtcccgac
cgtggggcttacctgccggcggcatcctatagcctggtaacccaatcgcagcataagaat
gtgcagcgtggggtattttcgttttgtatgtgtccgggaggttttatcgttccggcggct
acgtcgcccggagaattagtggtcaacgggatgtcgccgtcgcggcgcgattcacgtttt
gccaattcgggcatggtcgtgagcatcgaagatgttgatttaaagccgtatgccgcattc
ggtgcgttggcgggactggagttgcaacgcgtcattgaacagaaagcctgctccttggcg
ggaggaggtcaaacggctcccgcgcaacgggtactggattttgtgaaaggaaaaacctct
cccgaattgttggacacttcataccaacccggattgctgtcgatggacctgcgcgaatac
ctgcccgcccatattgccgagccgctgcgtcagggattgcaggattttggccgcaaaatg
agcgggtatgtgtccaacgaagcgcaattgatcggggtagagagccgtacgtcgtcgccc
gtgcggattccgcgccaccgtgaaaccgccgagcatatctatacacaacggctgtatccc
tgcggtgaaggggccgggtacgcgggaggaatcatgtcggcggcgctggacggcaccttt
gtggctgagcagttggtgaatcggtacggaaaatga

DBGET integrated database retrieval system