KEGG   Runella slithyformis: Runsl_5303
Entry
Runsl_5303        CDS       T01553                                 

Definition
(GenBank) NUDIX hydrolase
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: AEI51600
Position
6166590..6167210
AA seq 206 aa
MPFNDFISTLDTQLRQPLPGPEAHLKMASATRLRLKVQPNEKTRRSAVLILFYPYRDQIL
LPLILRPKYDGVHAGQMAFPGGRYEKTDENLIRTALREAQEEIGIKASDVHVLGKLTELF
IPPSNFYVLPVVGKLAYKPDFYPDPREVEAVLEVNLEELMDENIVGFTELDVRGITIEAP
FYDIQGHKVWGATAMMISELLTVIRQ
NT seq 621 nt   +upstreamnt  +downstreamnt
atgccttttaacgattttatcagtacgcttgacacccaactccgacaaccgttgccgggg
ccggaggcgcatcttaaaatggcatcggccacgagactgcggctcaaggtgcagcccaat
gaaaaaacgcgacgctcggccgtattgatcctgttttacccttaccgtgaccaaatcctg
ctcccccttattctgcgacccaaatacgacggagtccacgccggccaaatggcctttccg
ggcggacggtatgaaaaaaccgacgaaaacctcatccgaacggctctgcgcgaagctcag
gaagaaataggaatcaaagcctcagacgtgcatgtattgggaaaactcaccgaactgttt
attcctcccagcaatttttacgttctgcccgtggtaggtaagctggcctacaaacccgat
ttttaccccgatccccgcgaagtggaagcggtattggaagtaaatctggaagaactgatg
gatgaaaatatcgttgggtttaccgaactggatgtccgcggaattaccattgaagctcct
ttctacgatattcaggggcacaaagtgtggggagctactgccatgatgatcagtgaactt
ctgacggtgattcgtcaataa

DBGET integrated database retrieval system