KEGG   Runella slithyformis: Runsl_5304
Entry
Runsl_5304        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF2723 DUF2286
Other DBs
NCBI-ProteinID: AEI51601
Position
6167358..6170312
AA seq 984 aa
MSKFNRINTLTGWLVFAVALVTYLLTVERTASFWDCGEFIACSYKLQVPHPPGAPLFLLI
GRLFSMMAMGDVTQVAYWVNLVSVMSSAFTILFLFWSITLLARKLLGKKDEELSLADTIA
VVGAGLVGALAYTYSDSFWFSAVEAEVYGLSSFFTAIVIWAVLKWERIEDDAAANRWLIF
TFYLVGLSIGVHLLNLVTIPALALVYYFKKYKTPSLWGGIAAFAGGLVVLMIINSGVIVW
LPSTAGKFEIFFVNTLGAPFSVGIVFFIVLFIGVLIWGIRYSAKKEKEVWNTALLAFAFV
LIGYSSYFLVLVRSNFNPPINENDPSDVISYVSYLKREQYGSRPLLFGPVFTARPVNSER
GEPIYRKSNGKYIIADYRPEYVYEKNQQMLFPRVHSNQMNHPQLYRDKLGLAEGQKPSMG
DNLSFFFSHQLGHMYWRYFLWNFVGRESDEEGAGGLRPWDTSQGLPDVMATNRARDNFYM
IPFLLGLLGIVAQAFRRKQDLLVTGLLFMMMGVALVVYLNSPPVEPRERDYIYVGSFYIF
AFWIGLGVMFIYDFLTKVLPSAQARAGVATVIGLSAPLLMGVKGWDNHDRSHRYHSVDFA
KNLLNSCAPNAILFTGGDNDTFPLWYVQEVEGFRTDVRVCNLSLLGTDWYIGQMKRKTYE
SDPLPISLEYENFAAGKNDIVPFYEMPAVKNGINLKEYMALVKQNNAAIQVPLTSGEMTS
ILPSSVLVLGINPEQVKKMNILKPELASFVKDTMQWTMGKRDLYKSDLIMLDIIATNDWK
RPIYFSGTLTNDNYLNLKEFMQLEGYTYRLLPVRVPGASDGYVNTDIMADNLMKKTFWRE
LDNPKTYYDGTYKGSPAFSARIAFMRLVDQLIREGKTEKAKGALNFILTKMPDKTIPYDQ
ITANYVNYLFALNEPKKALEIAEVMSRRAEETLKYNQQHGVNQDTNIQLYILQTLANACR
EGKQEAQAKKYETLLQQYMTALGG
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgtctaaatttaaccgaattaacaccctgaccggctggcttgtctttgcagtagcgctg
gtgacttacctgctgactgttgagcgtacggccagtttttgggattgcggcgaattcatc
gcctgctcttacaaacttcaggtaccacaccctccgggcgcgcctcttttcttactcatc
ggccggttgttttccatgatggccatgggcgatgttactcaagtggcttattgggtcaac
ctcgtctcggtcatgtcgagtgcatttacgattttattcttattctggagcattacgctg
ttagctcggaaattgctgggtaaaaaagacgaagagcttagtttggccgatactattgca
gtggtaggcgcaggcctcgtcggtgcgttggcatatacctattccgattcgttttggttt
tcggcggtagaagctgaagtgtacggtctgtcatcgttctttaccgccatcgttatttgg
gcggtcttgaagtgggagcgcatcgaagatgatgccgccgccaaccgttggcttattttt
accttctatttggtcggtctttccatcggtgtccacttattgaacctcgtgaccatccct
gcgctggcgttggtgtactacttcaaaaaatacaagactccttcattatggggaggcatt
gccgcttttgcgggtgggttggtcgtattgatgatcatcaactccggcgtgatcgtgtgg
ctgccttctaccgcggggaaatttgagattttctttgttaatactttgggagcccctttt
tccgtcgggatcgttttcttcatcgtattatttatcggggtactaatttggggaattcgt
tattcggccaagaaagaaaaggaagtatggaatactgctttactggccttcgcttttgtg
ctgatcgggtattcatcttattttctggtattggttcgttccaacttcaacccgcccatc
aatgaaaacgaccccagcgatgtgatcagctatgtttcgtacctgaaacgcgagcagtac
ggaagccgtccgttgttgtttggacctgtctttacggctcgtccggtcaactcagagcgt
ggggagcctatctatcgcaaatcgaacggtaagtatatcattgccgattaccgccccgaa
tacgtgtacgagaagaatcagcagatgcttttcccgcgggtacacagcaatcaaatgaat
cacccgcaactgtaccgggataaactgggattggccgaaggccaaaaaccgagcatgggc
gacaacctgtcgtttttcttctcgcatcagctcggccacatgtattggcggtatttcctc
tggaattttgtcggtcgtgaaagcgacgaggaaggcgccgggggtttacgcccgtgggat
acaagccagggcttgcccgacgtaatggctaccaaccgtgcccgtgataatttttacatg
atacccttcctgttgggcctgttaggcattgtggcgcaggcgttccgtcgtaagcaggat
ctcttggtgacgggattattgttcatgatgatgggggtggcactggtcgtgtacctcaac
tcaccgccggtagagccgcgcgaacgggattatatttacgtcggttctttctacattttt
gcattctggattggactgggcgttatgtttatctatgatttcctgaccaaagtcctgcct
tccgctcaggctcgggcgggggtagccacggtcattggattgtcagctccgcttttgatg
ggcgtaaaaggctgggataaccacgaccgcagccatcgctatcattcagttgactttgcc
aaaaatctccttaattcctgcgcaccaaacgcgattctgtttacgggcggcgataatgac
actttcccgctatggtacgttcaggaggtggaaggcttccgtaccgacgtgcgggtgtgt
aatctgagcctcttgggtacggattggtacattgggcaaatgaagcgtaagacctacgaa
tcagaccctttgccgatctcactggaatacgaaaacttcgccgccggtaaaaacgacatt
gtgcctttctatgaaatgccggccgttaaaaacgggatcaatctgaaagaatacatggcc
ttggtcaaacaaaacaatgccgcgattcaggtaccgctgaccagcggtgaaatgaccagt
atcttaccttcttcggtattggtattgggaattaacccggagcaggtcaagaaaatgaac
atcctgaagcccgagctggcgtcatttgtaaaagataccatgcaatggaccatgggcaaa
cgcgatctctacaagtcggacctgatcatgctggacatcattgcgaccaacgattggaaa
cggcccatttatttctccggaacgctgaccaatgataactacctcaatctgaaagaattc
atgcagttggaaggctacacctaccgcctgttgccggtacgcgttcccggggcttccgat
gggtatgtaaataccgatatcatggccgataacctcatgaagaaaacgttctggcgggaa
ttggacaacccgaaaacctattacgacggcacctacaaaggttcaccggcgttttctgcc
cggattgcatttatgcgtctggttgaccagttgatccgtgaaggcaaaaccgagaaagct
aaaggggcgcttaattttatcctgaccaaaatgccggataaaaccattccgtacgatcag
atcacggccaattatgtgaactatctgtttgcgttgaatgagcccaagaaagcccttgag
attgcggaagtgatgagtcggcgtgcggaagagactctcaaatacaatcagcagcacggg
gtgaatcaggataccaatattcaattatatattctgcagacgctcgccaacgcgtgtcgt
gaaggaaagcaggaagcacaggctaagaaatacgaaaccctgttgcaacagtacatgacg
gccctgggtggctag

DBGET integrated database retrieval system