KEGG   Runella slithyformis: Runsl_5305
Entry
Runsl_5305        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF423
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF423 DUF2721
Other DBs
NCBI-ProteinID: AEI51602
Position
complement(6170415..6170798)
AA seq 127 aa
MSTKFFLQAGAVLGILGVALGAFGAHALKPTLEASGRMDTFETAVKYQFYHALALVLISI
LLQNAAITSAKWYQWAGYSFLGGVIVFSGSLYTICFTGIKAFGAVAPIGGTLMIAGWVLL
FLGAAKQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcgactaaattttttcttcaggcaggtgccgttttgggcatattgggagttgcttta
ggcgcgtttggggcccatgccctcaaacccacgctggaagcttccggacgcatggacacc
tttgaaaccgccgtaaaataccagttctaccatgcgttggccctcgtactgatcagtatt
ttgctacaaaacgcggccattacttccgccaagtggtaccaatgggccgggtattccttt
ttgggcggggtgatcgttttttcgggctctttgtataccatctgctttacgggtatcaag
gcgtttggggcggtagctcccatcggcggcacgctcatgatcgcgggctgggtactcttg
tttttaggggctgcgaagcagtag

DBGET integrated database retrieval system