KEGG   Runella slithyformis: Runsl_5306
Entry
Runsl_5306        CDS       T01553                                 

Definition
(GenBank) glycosyl transferase family 9
  KO
K02849  heptosyltransferase III [EC:2.4.-.-]
Organism
rsi  Runella slithyformis
Pathway
rsi00540  Lipopolysaccharide biosynthesis
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Runsl_5306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rsi01003]
    Runsl_5306
   01005 Lipopolysaccharide biosynthesis proteins [BR:rsi01005]
    Runsl_5306
Enzymes [BR:rsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     Runsl_5306
Glycosyltransferases [BR:rsi01003]
 Polysaccharide
  Bacterial polysaccharide
   Runsl_5306
Lipopolysaccharide biosynthesis proteins [BR:rsi01005]
 Core region
  Runsl_5306
SSDB
Motif
Pfam: Glyco_transf_9
Other DBs
NCBI-ProteinID: AEI51603
Position
6171065..6172114
AA seq 349 aa
MDLSAFRALWLHRYRKYTYILGEYVRALGTIAHFSALKISFRGRKQLVAILRTEHFGDIV
AAEPLARQVRALTPDAYIVWIVRPVFKELVERHPEIDEVWAQPSVLQRKLVCESGVFEKM
YNLEFWQSNRDPISEHVHQNRVAAQKDITVFNYFEKGNLLSIFQQCAELPVLDDAPRVYI
DDVDRERVDALQLPEKLIVIHCSSNYPTKDWSVENWHTLTNWLMLEKGYYVAEIGLKNVI
QTAHPQYINLCGQFSILQTAEIIRRAHFFVGIDSGPAHLANAVGTFGVLLFGRLNNFDAY
MPYSGDYRNGNNALMIREPGKTCAALDYGLVKAEMETVLEQIPKAATVI
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggatctatccgctttcagggccctatggctgcatcgttatcgtaaatacacctatatt
ctgggagaatacgttcgggcgttgggtacaattgcgcatttttcagcgcttaaaatttca
tttagaggtcgaaaacaattggtcgccattcttcgtaccgaacacttcggcgacattgtg
gcggcggaaccgctggcccgtcaggtacgggcgcttacgcccgatgcgtatatcgtctgg
atcgttcgtcccgtatttaaagaattggtggaacgtcatcctgagattgatgaagtgtgg
gcccaaccttcggtattgcagcgtaagttagtgtgcgagtcaggcgtttttgaaaagatg
tataaccttgaattctggcaaagtaatcgtgatcccatcagcgagcatgtgcatcaaaac
cgcgtggccgcccaaaaggatattaccgtttttaactattttgaaaaagggaatctgctt
tccatctttcagcaatgcgcggagttgccggtcctggacgatgccccccgggtatacata
gatgatgtggatcgtgaacgggtagatgccttacaattgcccgaaaaactgatcgtcatc
cattgcagttccaattatcccaccaaagactggtcggtagagaactggcacacattgaca
aattggctgatgttggaaaagggctattacgtggccgagatcggtcttaaaaatgtgatt
caaacggcacatccgcagtatataaacctttgcggtcagttctcgatcttacaaacggcc
gaaatcattcgccgtgcgcatttttttgtcggtatcgatagcgggccggcccatttggcc
aatgctgtgggtacgttcggggtgctgttatttggccggttaaacaattttgatgcgtat
atgccctattcgggagattaccgaaacggaaacaatgcgctgatgatccgagagcccggc
aagacctgtgctgcgttggattatggattggtgaaggccgaaatggagactgttttagaa
caaatacccaaagcagccacagttatatag

DBGET integrated database retrieval system