KEGG   Runella slithyformis: Runsl_5307
Entry
Runsl_5307        CDS       T01553                                 

Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
rsi  Runella slithyformis
Pathway
rsi03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Runsl_5307
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rsi03032]
    Runsl_5307
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Runsl_5307
DNA replication proteins [BR:rsi03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Runsl_5307
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase DUF2520
Other DBs
NCBI-ProteinID: AEI51604
Position
6172217..6173818
AA seq 533 aa
MDNDKSYNFLQKKSLGNNSRANTSNRWLESGTGLGKLPPQALELEEAVLGALMIEKDALN
AVIDILKSDSFYKEAHQRIYNAIITLFTNSEPIDLLTVTNQLRQLGELEIVGGAQYVTSL
TTKINSAANIEYHARVVAQSAMKREMITVASKILQDAFEDTTDVFTLLDAVEQSLFKISE
SNIRKNYADMSTLMNEALKELERRREQKDGLTGVPSGFTQLDRLTSGWQPTELIILAARP
AMGKTAFVVSSLRNAAVDFGMPVAIFSLEMSAVQLVNRMISAEAELDSEKLKKGNLAPHE
WTQLHQRIDRLMRAPIFIDDTPALSILELRAKCRRLKQQHDIQMVVIDYLQLMQGDGGKG
GGNREQEIASISRALKNLAKELNVPVIALSQLSRAVETRGGDKRPQLSDLRESGSIEQDA
DMVAFLYRPEYYGFTQDEAGNSVQGIGEVIVAKNRSGSLDTIQLRFIGKYTKFTDLDGYY
SSNTPNNAALNSGAIPASFETPSPAAGGTFRSKANDLGAMNFPPPNPSEEPPF
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggacaacgataaatcatacaattttcttcaaaagaaatcgctcggaaataactcccgt
gccaataccagcaatcgttggctggaaagcggtaccggtttggggaagttgccgccgcag
gccctggaattggaagaggcggtactgggagctttgatgattgagaaagatgcgctcaat
gcagtcattgatattttaaagtcagacagtttctacaaagaagcgcatcagcgcatttat
aacgcgatcattaccctctttaccaattcagaacccattgatcttttgacggttacgaat
cagttgcgtcaactgggtgaactggaaattgtaggaggagcgcagtatgtaacgtcgttg
accaccaagattaactcggcagccaacattgaatatcacgcgcgggtcgtggctcaatcg
gccatgaaacgcgagatgatcacggtcgcttccaaaatattacaggatgcctttgaagat
accaccgacgtttttacgcttcttgatgcggtagaacagtcgctttttaaaatttcggaa
tccaatattcggaagaattacgccgacatgagcacgctcatgaacgaggcgttgaaggaa
ctcgaacgccgtcgcgaacaaaaagacggattgaccggggtgccttcgggctttacccaa
ttagaccgtctgacctcaggctggcaacctaccgaattgatcatcctggcggcacgtcct
gcgatgggaaaaaccgcttttgtggtttcatcgctgcgcaacgcagccgttgacttcggt
atgccggtagcaattttctcattggagatgtcggcggtacagttggtcaatcgtatgatc
tcggccgaagccgagctggacagtgaaaaattgaaaaagggtaatcttgcgccgcacgaa
tggacgcagctgcaccaacgcatcgaccgtttgatgcgggcccctatttttattgatgat
actcccgcgctttccatcttggagctgcgggccaaatgccgccgcctcaagcaacagcat
gatattcagatggttgtgattgactaccttcagttgatgcagggagacggaggaaaaggc
ggaggaaaccgtgagcaggaaattgcctctatttcgcgggcactcaaaaacttagccaaa
gaactgaatgtaccggtgattgcgctgtcgcagttgagtcgtgcggtggaaacccgcggc
ggagataaacggccgcagttgtctgacttacgtgaatccgggtctattgagcaggatgcc
gacatggtcgcctttctgtatcgtccggaatattacggatttacccaagatgaagcgggt
aactcagtgcagggcatcggtgaggtgatcgtagctaaaaatcgcagcggctcgttggat
accattcagctgcgattcattggtaaatacaccaaatttaccgatttggacgggtattat
tcttccaacacgcctaacaatgccgcgctcaacagcggggcgattcccgcttcgtttgaa
acgccttcgcccgccgcgggggggacgttccgcagcaaagccaatgacttgggcgcgatg
aattttccgccgccgaatccttccgaagagccccctttttaa

DBGET integrated database retrieval system