KEGG   Runella slithyformis: Runsl_5308
Entry
Runsl_5308        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF3108
Other DBs
NCBI-ProteinID: AEI51605
Position
complement(6173933..6174883)
AA seq 316 aa
MNFCARFIVNSDVYTAGLIKISRQKPLPVFNRTCKGNKKELGSIICRANKNKECMLRHSV
IAVLVLLIFPAFHAKDSYRRVPQSSFGAGEHFEYRVHYGIFNAADAVVDVSPQIQQVNGR
PCYKISIVGTTLGAFSWFAKVRDEWQSWMDTSAIVSQKFYRNIQENNYRKVETTVFNHAT
DDAIVTDENGTKKFDVPDHIQDAISGYFYLRTLDFTKLQPNDVVDVPTFLESSVYKLKVK
YRGKDNVKTKFGKIKALKLTPLMPNNQLFKGENSIRIWVSDDANKVPIKVEVDLWVGSMV
MEVRSFRGARNNFNWY
NT seq 951 nt   +upstreamnt  +downstreamnt
ttgaacttctgcgcgcgttttattgtaaactcggatgtatatacggccggactcattaaa
atctcccgtcaaaaaccattgcctgtttttaatcgtacatgtaagggaaataaaaaagaa
ctcggaagtatcatctgccgtgcaaacaaaaacaaggaatgtatgcttcgacacagtgtc
atcgccgtattggttttgcttatttttccggcctttcacgccaaagactcgtatcgccgt
gtgcctcaatccagctttggcgcaggggagcattttgaatacagggtacattatgggatc
ttcaacgccgccgatgcggtcgtagacgtaagtcctcaaatacagcaggttaacggccgt
ccgtgctacaagatcagtattgtcggaactactttgggcgcgtttagctggtttgccaag
gtgcgcgacgaatggcaatcgtggatggatacgtcggccattgtctcccaaaagttttac
cgcaatattcaggaaaataattaccgtaaagtagaaacgaccgttttcaaccatgccact
gatgatgcgatcgtgactgatgaaaacggcaccaaaaagtttgacgtcccggaccatatc
caggacgccatcagcggctatttttacctgagaacgctggattttacaaaattacagccc
aatgacgtggtcgatgtgcctacgtttttggaatcttcggtctataaattaaaagtgaaa
taccgggggaaagataacgtaaagaccaagttcggaaaaataaaagcgttaaaactaacg
cctcttatgccaaacaaccaattgtttaaaggagaaaactcaattcgtatttgggtctct
gacgatgccaataaggttcccatcaaagtcgaggttgacctctgggtgggttcgatggtc
atggaggtccgttcgttccggggtgcccgcaacaatttcaactggtattga

DBGET integrated database retrieval system