KEGG   Runella slithyformis: Runsl_5309
Entry
Runsl_5309        CDS       T01553                                 

Definition
(GenBank) aminopeptidase
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Aminopep SprT-like
Other DBs
NCBI-ProteinID: AEI51606
Position
complement(6174891..6175922)
AA seq 343 aa
MLKKILAGVVVILLMLGIVYRELISYGYMQAKGQLHILFNTRPVAEVLRDPALPDSLKQR
LKLIGEIKQFAVDSLGLDSSGSYTDYYDQGGKPILWVLTACEPFRMVPKEWRFPVIGTFA
YKGFFDTTRAHTEEKLLKASGYDTRINEVSAWSTLGFFKDPVLSSMLYRSEGSLANLIIH
EMTHGTLFVKDNLELNENLASFVGDYGAVRFMKAKYGQNAPQIEKYEFRNRYSDALSQHI
VRGANQLDSLYKSFRPTLTTAQKERLKVAQIQHIVASSDTLLGGLVGQKYPWRGKELPNN
AFFIGYLTYHSQQNQFNKEFNEKFKGNFRAYLSYLKTKYPTSF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgctcaaaaagatccttgccggtgtcgttgtgatactgttgatgctcggtatcgtgtat
cgggaactgatcagttacgggtacatgcaggccaaaggacagcttcatattcttttcaat
acccgtccggtggccgaagtgttacgggaccctgccctccccgattcgctcaaacaacgc
ctaaaactgatcggtgagatcaaacagtttgccgtcgattcgctggggttggattcatcg
ggaagctatactgactattatgatcagggcggcaagcctattttatgggtgctcactgcc
tgcgagccattcaggatggtccccaaagagtggcgctttccggtcatcggtacgtttgcc
tacaaaggtttttttgataccacccgcgcccataccgaagagaagctccttaaagcgtcg
ggctacgacacccggatcaacgaagtatcggcctggagtacgctgggcttttttaaagac
ccggtattatcgtccatgctgtaccgcagcgaaggcagtctggccaacctcatcatccac
gaaatgacccacggtacgctgttcgtaaaagataacctggaactcaacgaaaacctggca
agttttgtcggcgattacggcgcggtgcgattcatgaaggccaaatacggtcaaaacgcc
ccgcaaattgaaaaatatgagttcagaaatcgatacagcgatgccctaagtcagcacatt
gtccgcggagccaaccaactggacagcctgtataaaagttttcgtcctacgctcaccacc
gctcagaaagagcggttgaaggtagctcagatccaacacattgttgcaagttctgacacg
cttttaggcggtttagtcggccaaaaatacccgtggcggggaaaagaacttcccaataat
gcgtttttcatcggctatctgacgtatcattcccaacaaaatcagttcaataaagagttt
aacgaaaagtttaaaggtaactttcgcgcctatctttcgtatttaaaaacgaagtacccc
acgtcgttttaa

DBGET integrated database retrieval system