KEGG   Runella slithyformis: Runsl_5310
Entry
Runsl_5310        CDS       T01553                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
rsi  Runella slithyformis
Pathway
rsi00270  Cysteine and methionine metabolism
rsi00920  Sulfur metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01230  Biosynthesis of amino acids
Module
rsi_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Runsl_5310
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Runsl_5310
Enzymes [BR:rsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Runsl_5310
    2.3.1.46  homoserine O-succinyltransferase
     Runsl_5310
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Other DBs
NCBI-ProteinID: AEI51607
Position
complement(6176038..6177072)
AA seq 344 aa
MAVTLFKYPYTFPLELGGELAGFQLAYTTHGTLNADRSNVLWICHALTGSSDPTDWWDGL
VGTGLHYDPKDWFIICVNVLGSHYGSTNALSINAKTNTPYYRTFPDISIRDNIYAFELLR
EELGIQRIHTLAGGSLGGQQALEWAIIQPDLIENLVLIATNALHSPWGIAFNESQRMAIK
ADPTWQESRPDAGTEGMKVARAIALLSYRNYDTYDFTQARDSNEQTDHFRAATYQQYQGD
KLAQRFNAFSYWTLSRMMDLHNVGRNRPSVTHALSQVKAHTLVVGISSDILFQPAEQKFL
ARHIPDAEYQEIDSLYGHDGFLIEYKQLKQILLAWETKSLPQRR
NT seq 1035 nt   +upstreamnt  +downstreamnt
ttggcagttactctattcaaatatccttacacgtttccgttggagctcggcggcgaatta
gcgggcttccaattggcgtacactactcacggcaccctcaatgccgaccgcagcaatgtt
ttatggatctgccacgccctgacgggcagctccgacccgaccgattggtgggacgggctg
gtgggtacgggactccactacgatcctaaggattggtttatcatctgcgtgaatgtgctc
ggctcgcactacggctctaccaatgccctgagcatcaacgccaaaaccaacaccccctat
tatcgtacgtttcccgatatcagtattcgcgataatatttacgcctttgaattactgcgg
gaagaattgggaattcagcgtattcataccctcgcaggcggctcactcggagggcaacaa
gccttggaatgggctatcatccaacccgatctgatcgaaaatctggtgctgatcgccacc
aatgcgctgcattctccgtgggggattgccttcaatgaatcccaacgcatggccattaaa
gctgaccctacgtggcaggaatctcgccccgatgcgggcactgaaggcatgaaagtggca
cgcgccattgcgctgttgtcgtaccgcaactacgatacctacgactttacccaagcccgc
gacagcaatgaacagaccgatcattttcgggccgccacctatcagcagtatcagggcgat
aaactggcccaacgttttaacgcgttttcgtattggaccctctcgcggatgatggatctg
cacaacgtaggccgcaaccgcccgagcgttacacatgccctttcgcaggtcaaagcccat
acgctggtggtaggcatcagctccgatatcttatttcagcccgccgagcagaaatttctg
gcccgtcatatccccgacgccgaatatcaggaaattgactcgctctacggccacgacggt
tttttgatcgaatacaagcagctaaaacaaattttgctggcctgggaaactaaaagcctc
ccgcaacgccgttaa

DBGET integrated database retrieval system