KEGG   Runella slithyformis: Runsl_5311
Entry
Runsl_5311        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF721
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DciA
Other DBs
NCBI-ProteinID: AEI51608
Position
6177499..6177819
AA seq 106 aa
MIYRFKKENAARRPGVTTVGDAIHKMLEMYRLRPQFDESSVKVYWEKLVGKEIASRTSDI
YVKDKVLFLRLDSAPLANELVIAKRKLIQSLNDSFGYELIVDIVFI
NT seq 321 nt   +upstreamnt  +downstreamnt
atgatttatcgtttcaaaaaagaaaacgccgcccggcgtccgggagtgaccactgttggc
gacgccatccataaaatgctggaaatgtaccgtctgcgcccgcagtttgacgagtcgtcg
gtgaaggtatattgggaaaagttggtgggaaaagagatcgcttcccgcacttcggatatt
tacgtcaaggacaaagtattgtttcttcgactggattcggcccctctggccaatgaattg
gtgatcgccaaacgcaagctcattcaatctctcaatgactcctttggctatgaattgatc
gtggacattgtatttatttaa

DBGET integrated database retrieval system