KEGG   Runella slithyformis: Runsl_5312
Entry
Runsl_5312        CDS       T01553                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K03696  ATP-dependent Clp protease ATP-binding subunit ClpC
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rsi03110]
    Runsl_5312
Chaperones and folding catalysts [BR:rsi03110]
 Heat shock proteins
  HSP100
   Runsl_5312
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 Clp_N ClpB_D2-small AAA AAA_5 AAA_16 Sigma54_activat IstB_IS21 AAA_22 RuvB_N TniB ATPase_2 AAA_18 UVR ResIII AAA_14 AAA_3 AAA_24 PhoH RNA_helicase AAA_7 NACHT AAA_25 DNA_pol3_delta2 Torsin NB-ARC DUF87
Other DBs
NCBI-ProteinID: AEI51609
Position
complement(6178152..6180677)
AA seq 841 aa
MEAKFSNRVKEVISLSREEALRLGHDYIGTEHLILGMIREGEGVALALLKKLGVSLEELR
VTIEQVTKGTATNNVKNLANIPLTRQSEKVLKITYLEAKIFKSPLIGTEHLLLSILRDPD
NLASQILAKFNVNYEIVKEMLEYQSSGTKPHAGPETDDDDERSMFGGGAQQGKDPKNTEK
SRTPVLDNFGRDLTKMAELGKLDPIVGREKEIERVAQVLSRRKKNNPVLIGEPGVGKTAI
AEGLALRIVQKKVSRVLFGKRVVTLDLASLVAGTKYRGQFEERMKAVMNELEKSPEVILF
IDELHTIVGAGGASGSLDASNMFKPALARGDIQCIGATTLDEYRQYIEKDGALARRFQIV
MVDAPSVEETIEILNNIKDKYEDHHHVNYTDEAIAQAVKLSERYITDRFLPDKAIDVMDE
VGARVHISNITVPEDIVVLEQQIEEVKKQKNLVVKSQKYEEAAQLRDREKKLLDQLDRAK
IAWEEETKKRRYTVTDENVAEVVAMMTGIPVNRVAQNEGQKLLGMGDELKNRVIGQNNPI
EKLTKAIQRTRVGLKDPKKPIGSFIFLGPTGVGKTELAKVLATYLFDKEDALVRIDMSEY
MEKFSVSRLIGAPPGYVGYEEGGQLTEKIRRKPYSVVLLDEIEKAHPDVFNILLQVLDDG
ILTDGLGRRVDFRNTIIIMTSNIGVRDLKDFGSGIGFATKAKSENQDDLMKSTIQSALRK
AFSPEFLNRLDDVIVFNSLQREDIHRIIDISLGKLFNRVTNLGYQVELTEKAKDFLSEKG
YDQQYGARPLNRAIQKYLEDPVAEEILKGDLREGDTLMADHEDGAETLVITVRKKEAEVI
N
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggaagcaaaattttcaaaccgcgtaaaagaagtcatttcactcagccgtgaagaagcc
ttgcggctggggcatgattatatcggcaccgagcatcttattctgggaatgataagagaa
ggagaaggagtagcgttggctttattaaagaaactgggcgtttctttggaagaattgcgc
gtaaccatcgagcaggttacgaaaggtaccgccaccaacaacgtgaaaaatctggccaat
attccattgacccggcaatctgaaaaggtgttaaaaatcacctacttagaagcaaaaatt
tttaaaagcccacttataggtacggagcacctgctactgtccattctgcgtgaccccgat
aacctggcctcgcagattttagccaagttcaatgtaaactatgaaatcgttaaggaaatg
ttagagtatcaatcatcaggcaccaaaccgcacgcggggcccgaaactgacgacgacgac
gaacggagtatgttcggaggcggtgctcagcaaggcaaagaccccaaaaataccgaaaaa
tctcgtacacctgtcttagacaatttcggtagagacctaaccaagatggcagaattgggt
aaattagaccctatcgttggccgtgagaaagaaattgaacgtgtagcgcaggtgctgagc
cgccgtaagaaaaacaaccctgtgctcatcggagagccgggtgttgggaagacggctatt
gctgaaggcttagcgctgagaattgtacaaaagaaagtttcgcgggtgctgttcggcaaa
cgcgtcgtaacgctggatttggcctcgctcgtagcgggaactaaatatagagggcagttt
gaagagcgtatgaaagcggtcatgaatgaactggaaaaatcacccgaggtgatcctgttc
attgatgagctgcacacgatcgtcggggccggcggtgcttccggttcgctggatgcttcc
aatatgttcaaacctgctttggcccggggcgacatccaatgcattggagccaccacattg
gatgagtatcgtcaatatattgagaaagacggcgcgttggcccgtcgttttcagatcgtg
atggtcgatgccccaagcgtggaagaaaccattgaaattctgaataacatcaaagataag
tacgaagaccaccaccacgtaaactatacggacgaagctattgcgcaggctgtgaaactg
tcggaacgatatatcaccgaccgcttcctgcccgacaaagccatcgacgtcatggacgag
gtaggagcccgcgtacacatcagcaatatcaccgttccggaagatatcgtagtgctggaa
caacagattgaggaggtcaagaagcagaaaaacctcgtggtgaaaagccagaaatacgag
gaagccgctcaactccgcgaccgtgagaagaagcttttagaccaacttgaccgtgctaag
atcgcctgggaagaggaaaccaagaagcggcgttataccgttacagacgaaaacgtagct
gaagtggtagctatgatgacggggattccggtcaatcgggtagcacaaaatgaaggccag
aaattgctcggtatgggtgatgaactcaaaaatcgggtgattggccaaaacaacccgatc
gaaaaactgaccaaagctattcaacggactcgggtaggattgaaagatcctaaaaaaccc
atcggctcgtttattttccttggtccgacgggcgtgggaaaaacggaattagcaaaggta
ttggcgacttacctgtttgataaggaagatgccttggtacggattgatatgagcgaatac
atggagaagttcagcgtatcgcgcctcatcggagcgcctccgggctacgtaggatatgaa
gaaggcgggcaattgaccgaaaagattcgtcgtaagccgtacagtgtcgtattgttggat
gagatcgaaaaagcgcacccggatgtattcaatattctgcttcaagtgctcgacgacggt
attttgacggatggattgggccgtcgtgtagacttccgtaataccatcatcatcatgacg
tccaacattggagtgcgtgatctgaaagattttggttcgggcatcggttttgcgaccaaa
gccaaatccgaaaatcaggatgatctgatgaagagtaccattcagagcgcgttgcgtaaa
gcattttctcctgaattcctgaaccgtttggatgatgtgatcgtattcaattcattgcag
cgcgaagatattcaccgcattattgatatctcactgggtaaactgttcaaccgcgtaacc
aaccttggctatcaggtggaactgacggaaaaggccaaagactttttgtcggaaaaaggc
tatgaccaacagtacggtgcgcgtccgcttaaccgcgcgatccaaaaataccttgaagat
cccgtcgcggaagaaattcttaaaggagatttgcgggaaggagatacgctcatggccgac
catgaagacggagccgaaacactggtgattacggttagaaaaaaagaagcggaggtcatt
aattaa

DBGET integrated database retrieval system