KEGG   Runella slithyformis: Runsl_5686Help
Entry
Runsl_5686        CDS       T01553                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
rsi  Runella slithyformis
Pathway
rsi00030  Pentose phosphate pathway
rsi01100  Metabolic pathways
rsi01120  Microbial metabolism in diverse environments
rsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Runsl_5686
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Runsl_5686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD PALP GDP_Man_Dehyd Polysacc_synt_2 Ldh_1_N THF_DHG_CYH_C Eno-Rase_NADH_b NAD_binding_4 DUF1776
Motif
Other DBs
NCBI-ProteinID: AEI51975
UniProt: F8EQT4
Position
pRUNSL01:complement(47513..48304)
Genome map
AA seq 263 aa AA seqDB search
MRLQHKKALVTGASGGIGKAIALQLAREGCTVGIHYLDKAEEARQVAEEIRAMGRTVYVF
QADLSEPQQAKQLGNEAWKMMQGLDFLVNNAGVSYKKHFLDVTVDDLETFTNINFKGTFF
LTQTIARRMVETQTEGSIYTITSVNALRPGLGLSTYGATKGALETLMQGVAMELAPHRIK
VNTIALGAFRTDITAAVWKNPALLKEVNDGIPLGRFGLPHEAAAVVVDLLTSGSYLTGAS
LTLDGGLLLMRGYGKPSPYQNEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttacaacataaaaaagcccttgtgacgggtgcctccggcggtattggaaaagcc
attgccctgcaattggcgcgggagggctgtacggtggggattcattacctggacaaagcg
gaagaagcccgacaggtggccgaagagattcgggcgatgggcaggacggtgtatgtgttt
caggcggacctgtcggagccccaacaggccaaacaattgggaaatgaagcctggaaaatg
atgcagggcctcgattttttagtgaataacgcgggggtttcctacaaaaaacactttctg
gatgtaaccgtcgatgacctggaaaccttcacgaatatcaatttcaaaggcacttttttc
ctgacccaaaccattgcccgaagaatggtcgaaacccaaaccgaaggcagcatttacacc
atcacttcagtgaatgccctgcggcccggtttggggctaagcacctatggtgctaccaaa
ggcgctctcgaaaccctgatgcagggagtagcgatggaattggccccgcaccgaatcaag
gtaaataccattgcgctcggcgctttccggactgatatcacggcagcggtttggaaaaac
cccgctttgctcaaagaagtaaacgatgggattccactcggccgcttcggcctgccgcac
gaagcagcagccgttgtggtagatctgctgacttccggcagctatctgacgggtgcaagt
ctgaccctcgacggcggactgctgctgatgcgcggttacggaaagccgtcgccctatcaa
aacgaagaataa

DBGET integrated database retrieval system