KEGG   Rhodobacter sphaeroides KD131: RSKD131_0130Help
Entry
RSKD131_0130      CDS       T00844                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00071  Fatty acid degradation
rsk00350  Tyrosine metabolism
rsk00625  Chloroalkane and chloroalkene degradation
rsk00626  Naphthalene degradation
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0130
  Lipid metabolism
   00071 Fatty acid degradation
    RSKD131_0130
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSKD131_0130
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSKD131_0130
   00626 Naphthalene degradation
    RSKD131_0130
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSKD131_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C NADH_4Fe-4S ThiF UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACL99989
UniProt: B9KLZ2
Position
1:126410..127534
Genome map
AA seq 374 aa AA seqDB search
MKITAAVLERDGIAGNYAEERPLAIRELDLAAPGPGEVLIRVAAAGICHSDLSVINGTRR
RPLPMVLGHEASGHVEALGEGVEDLEPGDHVVCIFAPGCGRCTPCAEGRPALCEKAARHH
AVGELMTGHRRLSLGGRPVHHHLGISGFATHAVVARPSLVRVPREVPPHVSALFSCAMLT
GAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIVAIDPFPAKMEAARAMGAT
LSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVTRRGGMTVTAGLPHPDDRMS
LEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLPVEKMLTHRLKLDEINLAMDR
LAEGSAIRQVVDLG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacggcggcggtgctcgaacgcgacgggatcgcggggaattatgccgaggag
cggccgctcgcgatccgcgagctcgatctcgcggcgccggggccgggcgaggtcctgatc
cgggtggccgccgcgggcatctgccattcggacctgtcggtcatcaacggcacgcggcgg
cggccgctgccgatggtgctcggccacgaggcctcgggccatgtcgaggctctgggcgag
ggggtcgaggatctcgagcccggcgaccatgtcgtctgcatcttcgcacccggctgcggc
cgctgcacgccctgcgccgaggggcggcctgcgctctgcgagaaggcggcgcgccatcat
gcggtgggcgaactgatgaccgggcaccggcggctctcgctcggcgggcggcccgtgcac
catcacctcggcatctcgggctttgccacccatgccgtggtggcgcggccctcgctggtt
cgcgtcccgcgcgaggtcccgccccatgtctcggcgcttttctcctgcgccatgctgacg
ggggcgggggccgtcttcaacacggcgcagatccggcccggctcgaaggtcgccgtggtg
gggctgggcggcgtcggactgtccgccatcctcggcgcggcggcggcgggcgcggccgaa
atcgtggcgatcgacccgtttcccgccaagatggaggccgcgcgcgccatgggcgcgacg
ctctcggtgcccgcggacggagatacggtcgcggcggtgcgcgacctgacggcgggcggc
gtcgattacgccttcgagctggcgggctcggtccgggcgctggaaaccgccttcgccgtc
acccgccgcggcggcatgacggtgaccgcgggcctgccccacccggacgaccggatgtcg
ctcgaagcgctgaagctcgtggccgaggagcgcaccctgaagggcagctacatcggatcc
tgcgtgccccagcgcgacctgccgcggatgctggcgcttcaccgccgcggcctgctgccg
gtcgagaagatgctgacccaccggctgaagctcgacgagatcaacctcgcgatggaccgg
ctggccgagggcagcgcgatccggcaggtggtggatctcggctga

DBGET integrated database retrieval system