KEGG   Rhodobacter sphaeroides KD131: RSKD131_0223Help
Entry
RSKD131_0223      CDS       T00844                                 

Definition
(GenBank) Butyryl-CoA:acetate CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00072  Synthesis and degradation of ketone bodies
rsk00280  Valine, leucine and isoleucine degradation
rsk00650  Butanoate metabolism
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RSKD131_0223
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RSKD131_0223
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSKD131_0223
Enzymes [BR:rsk01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     RSKD131_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: ACM00083
UniProt: B9KM85
Position
1:complement(222785..223414)
Genome map
AA seq 209 aa AA seqDB search
MAWDRNQMAARAAQELQDGWYVNLGIGIPTLVANYIPEGIEVTLQSENGMLGMGPFPFEG
EEDADLINAGKQTITELPKTAYFDSAQSFAMIRGGKIAMAILGAMEVAENGDLANWMIPG
KLVKGMGGAMDLVAGVQRVVVVMDHTSKHGESKVLKHCTLPLTGQGVVNRIVTNLGVLDV
VPGGLRIVECAEGVTEAELRAATEATIVD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggatcgcaaccagatggcggcacgcgccgcgcaggagcttcaggacggctgg
tatgtcaacctcgggatcggcatcccgacgctggtggccaactacatccccgaagggatc
gaggtgacgctgcaatccgagaacggcatgctcggcatgggtcccttccccttcgagggc
gaggaggatgcggacctcatcaacgcgggcaagcagacgatcaccgaactgcccaaaacc
gcctatttcgacagtgcccagagcttcgccatgatccgcggcggcaagatcgccatggcg
atcctcggcgcgatggaggtggccgagaacggcgatctggcgaactggatgatcccgggc
aagctcgtgaaggggatgggcggggcgatggatctcgtggcgggcgtgcagcgcgtggtg
gtggtgatggaccacacgtcgaagcacggcgagtcgaaggtgctgaagcactgcaccctg
ccgctgaccggtcagggcgtggtcaatcgcatcgtgaccaacctcggcgtgctcgatgtc
gttccgggcggtctccggatcgtggaatgcgccgaaggcgtgaccgaggccgagctgcgg
gccgcgaccgaggccacgatcgttgactga

DBGET integrated database retrieval system