KEGG   Rhodobacter sphaeroides KD131: RSKD131_0288Help
Entry
RSKD131_0288      CDS       T00844                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00970  Aminoacyl-tRNA biosynthesis
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSKD131_0288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsk03029]
    RSKD131_0288
Enzymes [BR:rsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RSKD131_0288
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RSKD131_0288
Mitochondrial biogenesis [BR:rsk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RSKD131_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACM00148
UniProt: B9KMT6
Position
1:complement(283801..285312)
Genome map
AA seq 503 aa AA seqDB search
MLDLTYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDC
AMPGMLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVEMAPGIARLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIRG
PEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELEAAAYFEE
VARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGKMAKDLF
EILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQV
IKATGGKANPAAVNQIVAEKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacctacgaagcccccaagcccaaggtgatcgccggggccaagcacgac
tgggaactggtgatcgggatggagatccacgcccaggtctcgtcgaatgccaagctcttc
tcgggcgcctcgaccaccttcggggccgagccgaactcgaacgtgtccttcgtggattgc
gcgatgccgggaatgctgccggtcatcaacgagttctgcgtggcgcaggcagtgcgcacc
ggcctcggcctgaaggcgcagatcaatctcttctcggccttcgaccgcaagaactacttc
tacccggacctgccgcagggctaccagatcagccagctctaccacccgatcgtgggcgag
ggcgaggtgctggtcgagatggccccggggattgcgcggctggtgcggatcgagcgcatc
catctcgagcaggatgcgggcaagtcgatccacgacatggacccgaatctctccttcgtg
gacttcaaccgcaccggcgtcgcgctgatggaaatcgtgagccgccccgacatccgcggg
cccgaggaggcggcggcctatgtggcgaaactccgccagatcctgcgctacctcggcacc
tgcgacggcaacatgcagaacggcaacctccgcgccgacgtgaacgtgtcggtctgccgt
ccgggacagtacgagaagtatcaggagacgcaggatttctcgcatctgggcacccgttgc
gagatcaagaacatgaactcgatgcgcttcatccagcaggccatcgattacgaggcgcgc
cgccagatcgccattctcgaggatggcggcaaggtggtgcaggaaacgcggctctacgat
cccgacaagggcgagacgcgctctatgcggtcgaaggaagaggcgcacgattaccgctac
ttccccgaccccgacctcctgccgctcgagatcgaacagggctgggtggacgagatcgcg
gcctcgatgcccgaactgccggacgcgaagaaggcccgtttcatggccgactatggcgtg
accgactacgacgccaatgtgctgacggccgaactcgaggcggcggcctatttcgaggag
gtggcccgcgggcgcgacggcaagcaggccgcgaactgggtcatcaacgaactcttcggc
cggctgaacaagcagggcctgaccatcgccgacacgccggtgaaggccggacagctgggc
ggggttctcgatctgatcgcgtcgggcgagatctccggcaagatggccaaggacctgttc
gagatcctctggaccgagggtggcgatccggcagaggtggccgcggcgcgcggcatgaag
caggtgaccgacaccggggccatcgagacggcggtcgacgagatcatcgcggccaaccct
gcgcaggtcgagaaggccaaggcgaaccccaaactcgcgggctggttcgtgggtcaggtc
atcaaggccacgggcggcaaggccaatccggccgccgtcaaccagatcgtggccgagaag
ctggggctctga

DBGET integrated database retrieval system