KEGG   Rhodobacter sphaeroides KD131: RSKD131_0480Help
Entry
RSKD131_0480      CDS       T00844                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsk  Rhodobacter sphaeroides KD131
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RSKD131_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACM00340
UniProt: B9KNR2
Position
1:complement(470445..471962)
Genome map
AA seq 505 aa AA seqDB search
MTLPPTRPAETAGTPEAGAPINQWKTLDKDLKRIVQLEQAGQFVGRPLLSLGIALVFIVV
AGVAASVIVGGTPNALVIVAAAAFGAYMALNIGANDVANNMGPAVGANALTMTGALAIAA
VFETAGALIAGGDVVSTISGGIVDPASVAEAGIFVWAMMAALIAAAVWLNVATAIGAPVS
TTHSIVGGVMGAGMVAAGLGAVNWPVMGQIAASWVISPVLGGVFAALFLAFIKHRLIDAE
DKIAAARFWVPLLIGVMAAAFSAYLVLKGLRKLMEVDLPAALLIGLVFGVLTVYLTRPLV
RRQSEGLENRKKSLKKLFGLPLVVSAALLSFAHGANDVANAVGPLAAIVHAVSDGDTAAK
VSIPLWVMIIGAGGISFGLVLFGPKLIRMVGSEITKLNPMRAYCVALSAAITVIVASGLG
LPVSSTHIAVGGIFGVGFYREWQAERRSRALGLIKGKPLPPEERKRRKLVRRAHFLTIGA
AWVVTVPATAALSAVIFLGLRTLGN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccaccgacccgacctgccgagactgcgggaacgcccgaggcgggcgccccg
atcaaccagtggaagacgctcgacaaggatctcaagcggatcgtccagctcgaacaggcc
ggccagttcgtcggccgcccgctcctctccctcgggatcgcgctggtcttcatcgtggtg
gccggcgtcgccgcctcggtcatcgtcggcggcacgcccaatgcgctcgtcatcgtcgcg
gccgcggccttcggcgcctacatggcgctgaacatcggcgccaacgacgtggccaacaac
atggggcccgcggtcggtgccaatgcgctgaccatgaccggggccctcgccatcgcggcg
gtcttcgagacggcgggggcgctcatcgcgggcggcgacgtcgtcagcaccatctcgggc
gggatcgtggacccggcctcggtcgccgaggccgggattttcgtctgggccatgatggcc
gcgctgatcgccgccgccgtctggctgaacgtggccaccgccatcggcgcgccggtctcg
accacccattccatcgtgggcggcgtgatgggtgcgggcatggtggcggcgggcctcggc
gcggtgaactggccggtgatgggccagatcgcggccagctgggtgatctcgccggtgctg
ggcggcgtcttcgcggcgctcttcctcgccttcatcaagcaccggctgatcgatgccgag
gacaagatcgcggcggcccgcttctgggtgccgctcctgatcggggtcatggccgcggcc
ttctcggcctatctggtgctgaagggcctgcgcaagctgatggaggtggatcttccggcg
gcgctgctgatcgggctcgtcttcggcgtgctgacggtctatctcacgcgcccgctggtg
cgccgccagtccgagggcctcgagaaccgcaagaagtcgctgaagaagctcttcggcctg
ccgctcgtcgtctcggccgcgctcctctctttcgcccatggcgccaacgacgtggccaat
gcggtgggcccgctcgcggccatcgtccatgcggtctcggacggcgacaccgccgccaag
gtctcgatcccgctctgggtcatgatcatcggggcgggcgggatctcgttcggtctggtg
ctgttcgggccgaagctgatccgcatggtcggatccgagatcaccaagctcaatccgatg
cgggcctattgcgtggcgctgtcggcggcgatcaccgtcatcgtggcctcggggctgggg
ctgccggtctcttcgacccacatcgccgtgggcggcatcttcggcgtgggcttctaccgc
gaatggcaggccgagcgccgcagccgcgccctgggcctcatcaaaggaaagcccctgccg
cccgaggagcgcaagcgccgcaagctggtgcgccgggcgcatttcctgaccatcggcgcc
gcctgggtggtgacggtgcccgccaccgccgcgctgtcggccgtgatcttcctcgggctg
cgcaccctcggcaactga

DBGET integrated database retrieval system