KEGG   Rhodobacter sphaeroides KD131: RSKD131_0799Help
Entry
RSKD131_0799      CDS       T00844                                 

Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00020  Citrate cycle (TCA cycle)
rsk00620  Pyruvate metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
Module
rsk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0799
   00020 Citrate cycle (TCA cycle)
    RSKD131_0799
   00620 Pyruvate metabolism
    RSKD131_0799
Enzymes [BR:rsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSKD131_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACM00659
UniProt: B9KQT2
Position
1:complement(802991..804319)
Genome map
AA seq 442 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQGAPKAAPAPAAKAP
EAQAARSEGGRVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPVAAPAAKAD
AAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH
FYLRREVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL
RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA
ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG
ALGAEFLKAIVENLENPIAMLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatcctgatgcccgcgctgtctccgacgatggaggaggggacgctcgcg
aaatggctgaagaaggaaggggatgaggtccgctcgggcgacatcatcgccgagatcgag
accgacaaggccaccatggagttcgaggcggtcgacgagggcatcctcggcaagatcctg
atcgccgagggcacggcaggcgtgaaggtcaacacgcccatcgccgtgctggtggaagag
ggcgagagcgtggacgccgtgtcctccgccaaggtgccggagccgcaggaaccggccgac
gaggccgcacccgcgcagggggctccgaaggcggcccctgccccggccgccaaggcgccc
gaggcgcaggcggcccgatccgagggagggcgcgtcttcgcctcgccgctcgcccgccgg
atcgccaaggaaaaggggatcgacctggcggccgtgcagggctcgggcccccgcggccgg
atcgtgaaggccgatgtcgagggggcgcaacccgtggccgctcccgccgccaaggcggat
gccgcggcaccgaaggcagaagcgcccgccgctgcggccgcgcccgtcgccgcgccggcg
gcctccgcggcttcggtggcgaagctcttcgcggatcgcgactatgaggaagtgaccctc
gacgggatgcgcaagaccattgccgcgcgtctgtccgaggccaagcagaccatcccgcac
ttctacctccgccgcgaggtggctctggatgcgctgatggccttccgcgccgatctcaac
gcgaagctcgagagccggggcgtgaagctctcggtcaacgacttcatcatcaaggcctgt
gcggtggcgctccagcaggtgccgaacgcgaatgccgtctgggccggagaccggatcctg
cggctgaagccctcggacgtggcggtggccgtggcgatcgagggcgggctcttcacgccg
gtcctgcgcgatgcgcaccagaagagcctgtcggcgctgtcggccgagatgaaggatctc
gccgcccgtgcccgcacgaagaagctcgcaccgcacgaatatcagggcggcagcttcgcg
atctcgaacctcggcatgttcggggtcgagaatttcgatgcggtcatcaacccgccgcac
ggctcgatcctcgccgtcggggcaggcatccgcaagccggtggtgggcaaggacggggcc
atcacgaccgccaccatgatgtcgatgacgctctcggtggaccaccgggtgatcgacggc
gcgctgggggccgagttcctgaaggcgatcgtcgagaatctcgagaacccgatcgccatg
ctggcctga

DBGET integrated database retrieval system