KEGG   Rhodobacter sphaeroides KD131: RSKD131_0943Help
Entry
RSKD131_0943      CDS       T00844                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00220  Arginine biosynthesis
rsk00330  Arginine and proline metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01130  Biosynthesis of antibiotics
rsk01230  Biosynthesis of amino acids
Module
rsk_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RSKD131_0943
   00330 Arginine and proline metabolism
    RSKD131_0943
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RSKD131_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACM00803
UniProt: B9KRL1
Position
1:complement(949026..949952)
Genome map
AA seq 308 aa AA seqDB search
MRKTCILIGAPIDSGQRRPGCLMGPAAYRVAGLGRALADLGHAVEDRGDVALGPLPEMTP
PEGPVHDLPETIGWTAALKTAVEEALGDGFPIVMGGDHSLALGTVAGAAAHAAAEGRPLF
LLWLDAHSDFHTLQTTTSGNLHGVPVAYAAGRDGFDGFPPFPAPLPPERICLFGIRSVDP
EEHAALLLHDVSIIDMRVIDEFGICAPMREFLETVRAANGMLHVSLDVDFVDPAHAPAVG
TTVPGGATVREAHLVMELLHESGLVTSLDLVELNPFLDERGRTARLMVELAASIMGRKVF
DRPTRSFG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacctgcatcctgatcggcgcgccgatcgacagcggccagcgccgcccgggc
tgcctgatggggcctgcggcctatcgcgtggcgggcctcggccgcgcgctcgccgatctc
ggtcacgcggtcgaggatcgcggcgacgtggccctcgggcccctgcccgagatgacgccg
ccggagggtccggttcacgacctgcccgagacgatcggctggacggccgcgctgaagacc
gccgtcgaagaggccttgggcgacggctttcccatcgtgatgggcggggatcattcgctt
gccctcggcaccgtggccggggccgcggcccatgcggcggcggaggggcggccgctgttc
ctcctctggctcgacgcccattccgacttccacacgcttcagaccaccacctccggcaat
ctccacggcgtgcccgtggcctatgcggccgggcgcgacgggttcgacggcttcccgccc
ttccccgcgccgctgccgcccgagcggatctgcctcttcggcatccgctcggtcgatccc
gaggaacatgcggcgctcctcctccacgatgtctcgatcatcgacatgcgggtgatcgac
gagttcggcatctgcgcgccgatgcgcgagttcctcgagacggtgcgcgcggccaacggg
atgctgcatgtctcgctcgatgtggatttcgtcgatcccgcccatgcgcccgcggtgggc
accaccgttccgggcggcgccacggtgcgcgaggcacatctggtgatggagcttctgcac
gagagcggtctcgtgacctcgctcgacctcgtggagctgaacccgttcctcgacgagcgc
ggacgcaccgcgcggctgatggtggagctcgccgcctcgatcatggggcgcaaggtcttc
gaccggcccacgcgcagcttcggctga

DBGET integrated database retrieval system