KEGG   Rhodobacter sphaeroides KD131: RSKD131_1337Help
Entry
RSKD131_1337      CDS       T00844                                 

Definition
(GenBank) Acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00020  Citrate cycle (TCA cycle)
rsk00620  Pyruvate metabolism
rsk00650  Butanoate metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
Module
rsk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSKD131_1337
   00620 Pyruvate metabolism
    RSKD131_1337
   00650 Butanoate metabolism
    RSKD131_1337
Enzymes [BR:rsk01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     RSKD131_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: ACM01197
UniProt: B9KJA0
Position
1:1369553..1371118
Genome map
AA seq 521 aa AA seqDB search
MPAGRDPHNFPSSEWLFREEGPMLDGVENDRIRHVGLRERVTSADEAAALIEDGMTVGMS
GFTRAGEAKAVPMALAARARQHPLKITLMTGASLGNDLDKTLAEAHVLARRIPFQSDPAL
RKAINRGEVMFIDQHLSETVEMLRTRQLPRVDVAVVEAVAITENGGIVPTTSVGNSASFA
ILAEKVIVEINLSQPAELEGLHDIYIPTYRPNRMPIPVVTPESRVGLPFIPIPPEKIAAI
VVTEKLDSSATILDPDADTRAIAGHLTEFLLHEVRAGRLDHTLQPLQAGIGTIANAVLHG
FIDTPFHDLKMYSEVLQDSTFDLFDAGKMRFASGSSITLSAQKYQEVLPRLVEYKPRLIL
RPQEISNHPEVVRRLGLICINTALEFDIYGNVNSTHVGGTQMMNGIGGSGDFARNAYLSV
FVTKSVAKHGAVSSVVPMVSHVDHTEHDVDILVTEVGLADLRGLAPRERAATIIANCVHP
DYRPMLRDYYDRACQRGGHTPHVLEEALSWHVRLAETGRMI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
ttgccggcaggccgggatccgcacaactttccgtcctccgaatggcttttcagggaggag
gggcccatgctcgacggtgtggagaacgacaggatccggcatgtcggcctgcgcgagcgc
gtgaccagcgcggatgaggctgcggccctgatcgaggacggcatgacggtcggcatgtcg
ggcttcacccgcgccggcgaggccaaggcagtgccgatggcgctcgcggcccgggcgcgg
cagcatccgctgaagatcacgctgatgaccggcgcctcgctcggcaacgatctcgacaag
acgctggccgaggcccatgtcctcgcccgccgcatcccgttccagtccgatcccgcgctc
cgcaaggcgatcaaccgcggcgaggtgatgttcatcgaccagcatctctccgaaacggtc
gagatgctgcgcacccgccagctgccgcgcgtcgatgtggccgtggtcgaggcggtggcc
atcaccgagaacggcggcatcgtgcccacaacctcggtcggcaactccgcctccttcgcc
atcctcgccgagaaggtcatcgtcgagatcaacctcagccagccggccgagctcgagggg
ctgcacgacatctacatccccacctaccggccgaaccggatgccgatcccggtggtcacg
cccgagagccgggtcggcctgcccttcatcccgatcccgcccgagaagatcgcggccatc
gtcgtgaccgagaagctcgacagctcggccacgatcctcgaccccgacgcagacacccgg
gccatcgccggccacctgaccgagttcctgctgcacgaggtgcgcgcaggacggctcgat
cacacgctccagcccctgcaggccgggatcggcaccatcgcgaacgcggtgctgcacggg
ttcatcgacacgccgttccacgatctgaaaatgtattccgaggtcctgcaggactcgacc
ttcgacctgttcgacgcaggcaagatgcgcttcgcctcgggctcgtcgatcaccctctcg
gcgcagaagtatcaggaggtgctgccgcggcttgtcgaatacaagccgcgcctgatcctg
cgcccgcaggagatctcgaaccatcccgaggtcgtccggcgcttgggcctcatctgcatc
aacaccgcgctcgagttcgacatctacggcaacgtgaactcgacccatgtggggggcacg
cagatgatgaacgggatcggcggctcgggcgatttcgcgcgcaacgcctatctctcggtc
ttcgtgacgaaatctgtggccaagcacggggcggtctcctccgtcgtgccgatggtgagc
catgtcgaccataccgagcatgacgtagacatcctggtgaccgaagtgggcctcgccgat
ctgcgcggcctcgccccccgcgagcgggccgccacgatcatcgccaactgcgtgcacccg
gactaccggccgatgctgcgcgactattacgaccgcgcctgccagcgcggcggccacacg
ccgcatgtgctggaagaggcgctgtcctggcatgtccggctcgccgaaaccggccggatg
atctga

DBGET integrated database retrieval system