KEGG   Rhodobacter sphaeroides KD131: RSKD131_2158Help
Entry
RSKD131_2158      CDS       T00844                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00860  Porphyrin and chlorophyll metabolism
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSKD131_2158
Enzymes [BR:rsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     RSKD131_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ACM02018
UniProt: B9KMC7
Position
1:2192101..2193546
Genome map
AA seq 481 aa AA seqDB search
MPAVMIQGTGSDVGKSLLVAGLCRAARRRGLSVAPFKPQNMSNNAAVTADGGEIGRAQAL
QARASGLEPLTDMNPVLLKPESDHGSQVILQGRRVGTLRARDWFERKPALMAPVLESFAR
LTAAHDLVIVEGAGSPAEVNLRRGDIANMGFARAAGVPVVLAGDIDRGGVIAQLVGTQAV
IEPEDAAMIAGFLVNKFRGDVRLFDEGYRLIEARTGWRGYGVVPFFPEAALLPAEDALDL
GRPTGQGALTVAWLAFSRVANFDDLDPLKQEPGLTVRMVRPGQPIPAEADLVILPGTKST
RGDLAFLRAQGWDVDLRAHHRRGGRVLGICGGYQMLGRSVADPEGLEGAPGVTEGLGLLD
VETVMHPDKRLTRVAGRHRASGAELTGYEIHIGATHGPDCARPFAQIEGRPEGATSADGR
VVGSYLHGMFGADGFRRAFLESLGAATSDLAYDARVETVLDALADHLETHVDVAGLLALA
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtgatgatccagggaacgggctcggacgtgggcaagtcgctgctcgtggcg
gggctctgccgggccgcgcggcgccggggcctgtcggtcgcccccttcaagccgcagaac
atgtcgaacaacgcagccgtcaccgccgacggcggcgagatcgggcgggcgcaggcgctg
caggcgcgcgcctccgggctcgagccgctgaccgacatgaacccggtgctgctgaagccc
gagagcgaccacggctcgcaggtgatcctgcagggccgccgcgtcggcacgctgcgcgcc
cgcgactggttcgagcgcaagcccgcgctgatggcgcccgtgctcgagagcttcgcgcgg
ctgacggcggcgcacgatctggtgatcgtcgagggggcgggcagcccggcagaggtgaac
ctgcgccggggcgacatcgccaacatgggctttgcgcgcgcggccggggtgcccgtggtg
ctcgcgggcgacatcgaccgcggcggcgtcatagcccagctcgtcggcacgcaggcggtg
atcgagcccgaggatgccgccatgatcgcgggcttcctcgtgaacaagttccgcggcgac
gtgcggctcttcgacgagggctaccggctgatcgaggcccgcaccggctggcgcggctat
ggggtggtgcccttcttccccgaagcggcgctcctgcccgccgaggatgcgctggatctg
ggccgccccaccgggcagggcgcgctgacggtcgcatggctcgccttctcgcgcgtggcc
aatttcgacgatctggatccgctgaagcaggagccggggctgaccgtgcggatggtgcgg
ccgggccagcccatcccggccgaggccgatctcgtgatcctgccgggcacgaaatcgacg
cggggcgatctggccttcctgcgggcgcagggctgggacgtggatctgcgcgcgcatcat
cgccgcggcggacgggtgctggggatctgcggcggctaccagatgctcgggcggagcgtg
gccgaccccgagggtctggagggcgcgccgggcgtgaccgaggggctggggcttctcgac
gtcgagacggtgatgcatcccgacaagcggctcacccgtgtggcggggcggcaccgggcc
agcggggccgagctcaccggctacgagattcatatcggcgcgacccacgggcccgactgc
gcccgccccttcgcccagatcgagggccgcccggaaggggccacctcggccgacggccgg
gtggtcggcagctacctccatggaatgttcggcgccgatggcttccggcgcgccttcctc
gagagcctcggggccgcgacctcggatctcgcctacgatgcgcgggtcgagacggtgctc
gacgcgctcgcggaccatctcgagacccatgtcgatgtggcggggctgctggcgctcgcc
cgctga

DBGET integrated database retrieval system