KEGG   Rhodobacter sphaeroides KD131: RSKD131_2178Help
Entry
RSKD131_2178      CDS       T00844                                 

Definition
(GenBank) Aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSKD131_2178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsk01007]
    RSKD131_2178
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsk03016]
    RSKD131_2178
   03029 Mitochondrial biogenesis [BR:rsk03029]
    RSKD131_2178
Enzymes [BR:rsk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     RSKD131_2178
Amino acid related enzymes [BR:rsk01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   RSKD131_2178
Transfer RNA biogenesis [BR:rsk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RSKD131_2178
 Prokaryotic Type
   Other AARSs
    RSKD131_2178
Mitochondrial biogenesis [BR:rsk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RSKD131_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD
Motif
Other DBs
NCBI-ProteinID: ACM02038
UniProt: B9KME7
Position
1:complement(2209467..2211242)
Genome map
AA seq 591 aa AA seqDB search
MHAYRSHTCTELNAAHVGQEVRLSGWVHRVRDHGGVLFLDLRDHYGITQVIADADSPAFA
ELETVRAEWVIRIEGRVKARDASLVNPKLATGEIEVYATGMSVLGAADELPLPVFGETDY
PEETRLTYRFLDLRREKLHQNMMLRSNVVRSLRNRMWGAGFNEFQTPIITASSPEGARDF
LVPSRLHPGKFYALPQAPQQFKQLIMVAGFDRYFQIAPCFRDEDPRADRSPTDFYQLDIE
MSFVEQEDVFAAVQPVIQGLFEEFGHGKRVEADWPRIAYRDAMLWYGSDKPDLRNPIKMQ
VVSEHFAGSGFAIFAKLLENEGTEIRAIPAPTGGSRKFCDRMNAFAQSQGLPGMGYIFWR
KGDDGAMEAAGPLAKNIGPERTEAIRQQLGLGEGDAAFFLGGKPETFEAVAGRARTEIGR
ELGLTEENCFKFAWIVDFPMYEKDDEGKIDFSHNPFSMPQGGMEALEGDPLKVHAYQYDL
ACNGYELISGGIRNHKPEIMFKAFELAGYPKEEVEKRFGGMVKAFRYGAPPHGGCAAGID
RIVMLLADEANIREVIMFPMNQRAEDLLMGAPSEPTNEQLRELRLRVVPKD
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcctatcgcagccatacctgcacggaactgaatgccgcgcatgtcggtcaggag
gtgcggctctcgggctgggtgcaccgtgtgcgcgaccacggcggcgtcctgttcctcgac
ctgcgcgaccattacggcatcactcaggtgatcgccgatgccgactcgccggccttcgcc
gagctcgagacggtgcgggccgagtgggtgatccgcatcgagggccgggtgaaggcgcgc
gacgcgtcgctggtgaaccccaagctcgcgaccggcgagatcgaggtctatgccaccggc
atgagcgtgctgggcgcggcggacgagctgccgctgccggtgttcggcgagaccgactat
cccgaggagacgcggctcacctaccgcttcctcgacctgcggcgcgagaagctgcaccag
aacatgatgctgcgctcgaacgtggtgcggtctttgcgcaaccggatgtggggcgcgggc
ttcaacgagttccagacgccgatcatcaccgcctcctcgcccgagggcgcgcgcgacttc
ctcgtgccgtcgcggctccatccgggcaagttctatgccctgccgcaggcgccgcagcag
ttcaagcagctgatcatggtggcgggcttcgaccgctacttccagatcgcgccctgcttc
cgcgacgaggacccgcgcgccgaccgctcgcccaccgacttctaccagctcgacatcgag
atgagcttcgtggagcaggaggatgtgttcgcggccgtgcagccggtgatccaggggctg
ttcgaggagttcggccacggcaagcgcgtggaagccgactggccgcggatcgcctatcgc
gatgcgatgctctggtacgggtcggacaagcccgacctgcgcaacccgatcaagatgcag
gtggtgagcgagcatttcgcgggctcgggctttgcgatcttcgccaagcttctcgagaac
gagggcactgagatccgcgcgatcccggcgcccaccggcggcagccggaaattctgcgac
cggatgaacgccttcgcgcagtcccagggcctgccggggatgggctacatcttctggcgc
aagggcgacgacggggcgatggaggccgcggggccgctggccaagaacatcggccccgag
cggaccgaagcgatccggcagcaactggggctgggcgagggcgatgcggccttcttcctc
ggcggcaagcccgagaccttcgaggccgtcgcgggccgcgcgcgcaccgagatcggccgc
gagctggggctgaccgaggagaactgcttcaagttcgcctggatcgtcgatttcccgatg
tacgagaaggacgacgagggcaagatcgacttcagccacaaccccttctcgatgccgcag
gggggcatggaggcgctggagggcgatccgctgaaggtgcatgcctatcagtacgacctt
gcctgcaacggctatgagttgatttcgggcggaatccgcaaccacaagcccgaaatcatg
ttcaaggccttcgaactggcgggctatcccaaggaagaggtcgagaagcggttcggcggc
atggtcaaggccttccgctacggcgccccgccccacgggggctgcgcggccgggatcgac
cggatcgtgatgctgctggccgacgaggcaaatatccgcgaggtcatcatgttcccgatg
aaccagcgcgccgaggatctgctgatgggcgcgccctcggagcccaccaacgagcagctg
cgcgagctgcgcctgcgcgtcgtgccgaaggactga

DBGET integrated database retrieval system