KEGG   Rhodobacter sphaeroides KD131: RSKD131_2832Help
Entry
RSKD131_2832      CDS       T00844                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00260  Glycine, serine and threonine metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_2832
Enzymes [BR:rsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RSKD131_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACM02692
UniProt: B9KR78
Position
1:2890164..2891183
Genome map
AA seq 339 aa AA seqDB search
MTIIDDFRSDTVTRPGPEMRAAMAAAEVGDAVYDDCPTTLRLEAVAAERLGKEASLFFPS
GTQSNLAAIMAHCERGDEFLVGQQAHAYRHEGGGAAVLGSVQPQPLPNGPDGCIPLDAIR
EAIKPADFHFARTRLLALENTFNGWVLDPAYVQAATALARDHGLATHLDGARLMNAAVAS
GQSAATLVAPFDTISLCLSKGLGAPVGSVLAGPRPVIERARRIRKMLGGGMRQTGVLAAA
ALHALERNVDRLAEDHARAARLAEVLSRFPALGSGPAQTNMVFMAPDGIDVASFKSFLSA
RGIAMGGGYGVLRWVTHLDLDDAALTRVAEACEAFFAGE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgacgacttccgctcggacaccgtgacccgccccggcccggagatgcgg
gccgcgatggctgcggcggaagtgggcgatgcggtctatgacgattgccccaccaccctg
cggctcgaggcggtggcggcggagcggctgggcaaggaggcctccctgttcttcccgtcg
ggcacccagtccaacctcgccgcgatcatggcgcactgcgagcggggcgacgagtttctg
gtcggccagcaggcccatgcctaccggcatgagggcggcggggcggcggtgctgggctcg
gtccagccgcaacccctgcccaatggccccgatggctgcatcccgctcgatgcgatccgc
gaggcgatcaagcccgccgatttccacttcgcccgcacccggcttctcgcgctggaaaac
accttcaacggctgggtgctggacccggcctatgtgcaggcggcgacggcgctggcgcgg
gaccatggccttgccacccatctggatggcgcgcggctgatgaatgccgccgtggcgagc
ggccagtctgcggccacgctcgtcgccccgttcgacacgatctcgctctgtctttccaag
gggctcggcgcgccggtcggctcggttctggccggtccgcgcccggtgatcgagcgcgcg
cgccggatccgcaagatgctgggcggcgggatgcggcagaccggcgtgctggccgccgcg
gccctccatgcgctcgagcggaatgtcgaccggctggccgaggaccacgcccgcgcggcg
cggctggccgaggttctgtcccgctttcctgcgctgggctccgggcccgcgcagaccaac
atggtcttcatggcgccggacgggatcgatgtcgcgtccttcaagagctttctgtcggca
cgcggcattgccatgggcggcggctacggcgtcttgcgctgggtcacgcatctcgatctg
gacgacgcggccctcacgcgcgtcgccgaggcctgcgaagccttcttcgccggagagtga

DBGET integrated database retrieval system