KEGG   Rhodobacter sphaeroides KD131: RSKD131_2885Help
Entry
RSKD131_2885      CDS       T00844                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00970  Aminoacyl-tRNA biosynthesis
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSKD131_2885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsk03029]
    RSKD131_2885
Enzymes [BR:rsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RSKD131_2885
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RSKD131_2885
Mitochondrial biogenesis [BR:rsk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RSKD131_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACM02745
UniProt: B9KRD1
Position
1:2939954..2941279
Genome map
AA seq 441 aa AA seqDB search
MDRLWMTAAELGRGIEDGRIHPVELAEAFLAAAADHPEGTRIYARLCPTRARTEAMAAAE
RAKRGLRRGPLDGVPVSWKDLFDTARVPTEAGSALLKGRVPAEDAAVLGTATLGGLVCLG
KTHMSELAFSGLGLNPVTATPPCVNDPAAVAGGSSSGAAASVAFGLAPAAIGSDTGGSVR
IPAAWNDLAGLKTTAGRLSLAGTVPLAARFDTVGPLARTVEDCALLLAVLEGGRPADLRG
ASLAGRRFLVLETLALEDLREAPARGFEEAVARLARAGAHIERGAAPEVVEAMAMAGPLF
TGEAYATWAEVIEGAPDLMFPRILERFRSGASITAVEFVTAWQRLEALRAAWAARTAGYD
AVLVPTSPILPPDAERLLTDENYYVGENLLALRNTRIANLMGLPALTLPTGQPSCGISLM
GQPMGEERLLRLGAAAERALG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggatcggctttggatgacggcggcggagctggggcggggcatcgaggacggcaggatc
catccggtcgagctggccgaggccttcctcgctgccgcagccgaccacccggaggggaca
cgcatctatgcgcggctctgcccgacgagggcccgcaccgaggcgatggccgcggcggag
cgggcgaagcgcggcctgcgccgggggccgctcgacggggtgccggtctcgtggaaggat
ctgttcgacacggcgcgtgtccccaccgaggcgggctcggcgctgctgaagggccgggtg
ccggcagaggacgccgcggtgctgggcaccgccacgctgggcgggctcgtctgcctcggc
aagacccacatgtccgagctggccttctcggggctgggcctcaacccggtgacggcgacg
ccgccttgcgtgaacgatccggcggcggtggcgggcggatcctcttcgggggcggcggcc
tcggtggccttcgggcttgcgccggcggccatcggctcggacaccggcggctcggtgcgc
attcccgcggcctggaacgacctcgcggggctgaagaccacggccggccggctttcgctg
gcgggcacggtgccgctcgccgcgcggttcgacacggtgggcccgctggcgcggacggtc
gaggattgcgccctgcttctcgccgtgctcgagggcgggcgcccggccgacctgcgcggc
gcctcgctggccgggcggcggttcctcgtgctcgagacgctggcgctcgaggatctgcgc
gaggcgccggcgcgggggttcgaggaggcggtcgcgcgcctggcccgggccggtgcccat
atcgagcggggggccgcgcccgaggtggtcgaggccatggcgatggcgggcccgctcttt
accggcgaggcctatgccacctgggccgaggtgatcgagggggcgcccgatctcatgttc
ccgcggatcctcgagcggttccgctcgggcgcgtcgatcacggcggtggagttcgtgacc
gcatggcagcggctggaggccctgcgggccgcctgggctgcgcgcacggcgggctatgac
gcggtgctcgtgccgacctcgcccatcctgccccccgatgcggagcggcttctgaccgac
gagaactactatgtcggcgagaatctcctcgcgctccgcaacacccggatcgccaatctg
atggggctgcccgccctgaccctgcccacgggccagccctcgtgcgggatctcgctcatg
gggcagcccatgggcgaggaacgcctgctgcgcttgggcgccgccgccgaacgggcattg
ggctga

DBGET integrated database retrieval system