KEGG   Rhodobacter sphaeroides KD131: RSKD131_2898Help
Entry
RSKD131_2898      CDS       T00844                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00053  Ascorbate and aldarate metabolism
rsk00071  Fatty acid degradation
rsk00280  Valine, leucine and isoleucine degradation
rsk00310  Lysine degradation
rsk00330  Arginine and proline metabolism
rsk00340  Histidine metabolism
rsk00380  Tryptophan metabolism
rsk00410  beta-Alanine metabolism
rsk00561  Glycerolipid metabolism
rsk00620  Pyruvate metabolism
rsk00625  Chloroalkane and chloroalkene degradation
rsk00903  Limonene and pinene degradation
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_2898
   00053 Ascorbate and aldarate metabolism
    RSKD131_2898
   00620 Pyruvate metabolism
    RSKD131_2898
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSKD131_2898
   00561 Glycerolipid metabolism
    RSKD131_2898
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSKD131_2898
   00310 Lysine degradation
    RSKD131_2898
   00330 Arginine and proline metabolism
    RSKD131_2898
   00340 Histidine metabolism
    RSKD131_2898
   00380 Tryptophan metabolism
    RSKD131_2898
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSKD131_2898
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSKD131_2898
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSKD131_2898
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RSKD131_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACM02758
UniProt: B9KRE4
Position
1:complement(2952960..2954420)
Genome map
AA seq 486 aa AA seqDB search
MIEKRDFYINGGWTAPAKARDCEVIDPSTEEACAVISLGDQADTDAAVAAAKAAFEGWAA
TPPAERLRLVKGILAQYEARKEEMAQAISLEMGAPIDLARNSQAPCLPWHLTNFLKAFEE
IEWVRPLGPHAPNDRIALEPIGVVGLITPWNWPMNQVTLKVIPALLAGCTCVLKPSEEAP
LSSLLFAEFVHDAGLPAGVFNLVNGDGAGVGTQLSSHPDVEMISFTGSTRAGRAISKAAA
ESLKRVTLELGGKGANLIFADADERAVERGVKHCFNNSGQSCNAPTRMLVERPFYDRAVE
IAAEVAAKTRVASAHEEGPHIGPVVNKRQFEQIQSYIQKGIDEGARLVAGGLGRPDGLNR
GFFVRPTVFADVTPGMTIEREEIFGPVLSILPFETEEEAVRIANDTPYGLTNYVQSEDGA
RRNRLARRLRSGMVEMNGKSRGAGAPFGGVKASGRAREGGVWGIEEFLEVKAISGWDPEA
EALAAE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagaaacgcgacttttacatcaacgggggctggaccgctccggccaaggcgcgg
gattgcgaggtcatcgacccgtcgaccgaagaggcctgcgcggtgatctcgctcggcgat
caggcggatacggatgcggcggtggccgcggcgaaggccgccttcgagggatgggccgcc
acgccccccgccgagcggctgcgcctcgtgaagggcatcctcgcacagtatgaggcgcgc
aaggaggagatggcgcaggcgatcagcctcgagatgggcgcgcccatcgaccttgcgcgg
aacagtcaggcgccctgcctgccgtggcacctgacgaacttcctcaaggccttcgaggag
atcgaatgggtgcgccccctcggccctcatgcgccgaacgaccggatcgcgctcgagccc
atcggcgtggtgggcctcatcacgccctggaactggccgatgaatcaggtgacgctgaaa
gtcatcccggcgctgctcgcgggctgcacctgcgtgctgaaaccctcggaggaggcgccg
ctctcctcgctcctcttcgccgagttcgtccatgatgcaggcctgcccgcgggcgtcttc
aacctcgtgaacggcgacggcgcgggcgtgggcacgcagctctcctcgcacccggatgtc
gagatgatctccttcaccggctcgacccgcgccggccgcgcgatctcgaaggccgcggcc
gagtcgctcaagcgcgtgacgctggaactcggcggcaagggcgcgaacctgatcttcgcc
gatgccgacgagcgcgcggtcgagcggggcgtgaagcactgtttcaacaactcgggccag
agctgcaacgccccgacccggatgctggtcgagcggccgttctacgaccgcgcggtcgag
atcgcggccgaggtggcggcgaagacccgcgtggcctcggctcatgaggaagggccgcat
atcgggccggtggtgaacaagcgccagttcgagcagatccagtcctacatccagaagggc
atcgacgaaggcgcgcggctggtggcgggcggcctcggccgaccggacgggctgaaccgc
ggcttcttcgtgcgccccacggtctttgccgacgtgacccccggcatgaccatcgagcga
gaggagatcttcgggccggtcctgtcgatcctgccgttcgagaccgaggaagaggcggtg
cggatcgccaacgacacgccctatggcctgacgaactacgtccagagcgaggacggggcg
aggcgcaaccgcctcgcccgccgcctgcgctcggggatggtcgagatgaacggcaaatcg
cgcggcgcgggcgccccgttcggcggcgtcaaggcctcgggccgggcgcgcgagggcggc
gtctggggcatcgaggagttcctcgaggtcaaggccatctcgggctgggatcccgaggcc
gaggcgctggccgccgaatga

DBGET integrated database retrieval system