KEGG   Rhodobacter sphaeroides KD131: RSKD131_3358Help
Entry
RSKD131_3358      CDS       T00844                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00071  Fatty acid degradation
rsk00072  Synthesis and degradation of ketone bodies
rsk00280  Valine, leucine and isoleucine degradation
rsk00310  Lysine degradation
rsk00362  Benzoate degradation
rsk00380  Tryptophan metabolism
rsk00620  Pyruvate metabolism
rsk00630  Glyoxylate and dicarboxylate metabolism
rsk00640  Propanoate metabolism
rsk00650  Butanoate metabolism
rsk00900  Terpenoid backbone biosynthesis
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
rsk01212  Fatty acid metabolism
rsk02020  Two-component system
Module
rsk_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSKD131_3358
   00630 Glyoxylate and dicarboxylate metabolism
    RSKD131_3358
   00640 Propanoate metabolism
    RSKD131_3358
   00650 Butanoate metabolism
    RSKD131_3358
  Lipid metabolism
   00071 Fatty acid degradation
    RSKD131_3358
   00072 Synthesis and degradation of ketone bodies
    RSKD131_3358
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSKD131_3358
   00310 Lysine degradation
    RSKD131_3358
   00380 Tryptophan metabolism
    RSKD131_3358
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSKD131_3358
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSKD131_3358
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSKD131_3358
Enzymes [BR:rsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSKD131_3358
Exosome [BR:rsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSKD131_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACM03218
UniProt: B9KWL4
Position
2:complement(264000..265160)
Genome map
AA seq 386 aa AA seqDB search
MAAEPIVIAGAARTPMGAFQGALKGRTGVELGAAAISAALVRAGLASEAVEEVVMGCVLP
AGLGQAPARQAALGAGLPLSVPCATLNKVCGSGMKAAMAAHDMIRAGSAGIVVAGGMESM
SNAPYLLDKARGGYRIGHGRVLDHMFLDGLEDAYDRGRAMGTFAEDCAEAYQFTRDAQDA
YALASLARAQAAIAEGRFAAEVVAVDGVAVDEAPGRARPEKIPQLRPAFREGGTVTAANS
SSISDGAAALVIASAGAAEAQGLTPLATIRGHASHAQAPNLFTTAPIFAIGKLLERVGWS
AAEVDLFEINEAFAVVAMAAMRDLDLPHDKVNVNGGACALGHPIGCSGARIVVTLIEALR
ARGLKRGVASLCIGGGEATALAVEVI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaaccgatcgtgatcgcgggggcggcgcggacgccgatgggcgcctttcag
ggcgcgctcaagggccggacgggggtcgagctcggcgcggcggcgatctcggcggcgctc
gtgcgggcgggcctcgcctctgaggcggtcgaggaggtcgtgatgggctgcgtgctgccc
gcgggcctcgggcaggcgccggcgcggcaggcggctctgggcgcggggctgccgctctcg
gtgccctgcgccacgctgaacaaggtctgcggctcggggatgaaggccgccatggccgcg
catgacatgatccgggcgggcagcgcgggcatcgtcgtcgcgggcggcatggagagcatg
tcgaatgcgccctatctgctcgacaaggcgcgcggcggctaccggatcgggcatgggcgc
gtgctggaccacatgttcctcgacgggctcgaggatgcctacgaccgcggccgcgccatg
ggcaccttcgccgaggactgcgccgaagcctaccagttcacccgcgacgcgcaggatgcc
tatgcgctggcctcgctggcccgggcgcaggcggccattgccgaggggcgcttcgcggcc
gaggtggtggcggtggacggggtggcggtggacgaggccccgggccgcgcccgccccgag
aagatccctcagctcaggcccgccttccgcgagggcggcacggtgacggcggccaacagc
tcctcgatctcggacggggcggcggcgctcgtgatcgcctcggccggcgcggccgaggcg
caggggctgaccccgctcgccacgatccgcggccatgcgagccatgcgcaggcgccgaac
ctttttaccacggcgccgatcttcgccatcgggaagcttctcgagcgggtgggctggagc
gcggccgaggtcgatctcttcgagatcaacgaggctttcgcagtggtggccatggccgcg
atgcgcgacctcgacctgccccacgacaaggtcaatgtgaacggcggcgcctgcgcgctc
ggccatcccatcggctgctcgggggcgcggatcgtggtgacgctgatcgaggcgctgcgg
gcgcggggattgaagcgcggcgtggcctcgctctgcatcggcggcggcgaggcgacggcg
ctggcggtggaggtgatctga

DBGET integrated database retrieval system