KEGG   Rhodobacter sphaeroides KD131: RSKD131_3651Help
Entry
RSKD131_3651      CDS       T00844                                 

Definition
(GenBank) OmpA/MotB domain protein precursor
  KO
K11892  type VI secretion system protein ImpK
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RSKD131_3651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsk02044]
    RSKD131_3651
Secretion system [BR:rsk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSKD131_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA DUF5337
Motif
Other DBs
NCBI-ProteinID: ACM03511
UniProt: B9KTY3
Position
2:573831..575192
Genome map
AA seq 453 aa AA seqDB search
MTREDDPFGLATDAARTRIRPSPAERARRAAAGPAPAEVGAVAPVRPAHGRTHPNPLVAS
FAVLLELAPALEGTAPPQEPGMLRARLRDGLTEARDRSVAQGVPLARADRAAWFVAALLD
DLALNTPWGAASGWPRQPLVTELSGEVDAGTRFFDRLEELARHPTLDPQLLELAWLCLSL
GFRGKHRTGREGGESALFALRTGVARLLRNPEAAAAPLSPHWEGVAAPDAPRRFAMPAWT
VGLAALALMAALYTGLSLQLSARAEKLFDLAALVPPVERAALFRPPRETVAPPPEIRVEP
VVIELLPAFRARAPAATAAALQGREDAQLTILTLQGTDPELFRSARAEVNPDYAPLVASV
AAVLAENRELVGAVRVIGHTDNVPVQRSNPFASNQGLSEARAATLAALLVEGGVPAGIVT
AEGHADTEPVADNATRAGRAQNRRVEIRIEKRL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggaggacgatccgttcggtctggcgaccgatgccgcccgcacccggatccgg
ccctctcccgccgaacgggcgcgccgggccgcagccgggcccgctccggccgaggtgggc
gccgtggccccggtccgcccggcccacgggaggacccatcccaatccgctcgtcgcgagc
ttcgccgtcctgctcgaactcgcgcctgcgctggaaggcaccgccccgccgcaggagccg
gggatgctgcgtgcgcggctccgcgacggcctgaccgaggcccgcgaccgaagcgtggcg
cagggcgtgccgctggcccgcgccgaccgcgccgcctggttcgtggcggcgctcctcgac
gatctggccctgaacacgccctggggtgcggccagcggatggccgcgccagccgctcgtg
accgagctgtcgggcgaggtcgatgcgggcacccgcttcttcgaccgcctcgaagagctc
gcgcgccatccgacgctcgacccgcagctgctggagctggcctggctctgcttgtcgctc
ggctttcgcggcaagcaccgcacggggcgcgagggcggcgagagcgcgctcttcgcgctc
cgcaccggcgtggcgcgccttctgcgcaatccggaggccgcggccgcgccgctctcgccg
cactgggagggggtcgcggcgcccgacgcgccgcgccgcttcgcgatgccggcctggacg
gtgggccttgcggcgcttgcgctgatggcggccctctacacgggcctctcgctgcagctg
tcggcgcgggccgagaagctcttcgatctggcggccctcgtgcccccggttgagcgcgcg
gccctgttccgccccccgcgcgagacggtcgcgccgccgcccgagatccgggtggagcca
gtggtgatcgagcttctgcccgccttccgggcccgcgcccccgccgccaccgcggccgcc
cttcagggccgcgaggatgcgcagctcaccatcctcacgctgcagggaaccgatcccgag
ctgttccgctcggcccgcgccgaggtgaacccggactatgcaccgctggtggcctcggtc
gcggccgtcctcgccgagaaccgcgagctggtgggggcagtccgtgtcatcggccatacg
gacaatgtgccggtccagcgcagcaatcccttcgcctcgaaccagggcctgtccgaggcc
cgcgccgccactctcgcggccctcctcgtcgagggcggcgtgcccgcggggatcgtcacc
gccgaaggccatgccgacaccgagccggtcgccgacaatgccacgcgcgcgggccgggcg
cagaaccgccgcgtcgagatccgcatcgagaagaggctctga

DBGET integrated database retrieval system