KEGG   Rhodobacter sphaeroides KD131: RSKD131_3977Help
Entry
RSKD131_3977      CDS       T00844                                 

Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00330  Arginine and proline metabolism
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSKD131_3977
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RSKD131_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ACM03837
UniProt: B9KUV9
Position
2:complement(923789..924751)
Genome map
AA seq 320 aa AA seqDB search
MSVLPTDSLSTPRFVGLPSFMRLPMATELQGLDAAIVGLPSDSGAPFRTGARFAPNALRA
MSVMLRPINPYRGHINIFEVLRVADAGDATCVPGYEIESLAALERALDAVVEAGAVPFGI
GGDHSVSLAGLRAVAKRHGPLGLVHFDSHTDTWDSYFDGKRYSAGTMFRRAIEEGIVDPA
RSIQVGMRGSLFQRADVSQSVDLGLEVITCDEMFALGLPETARRIAARSAGHPAFLSFDL
DFVDPAYAPGVETPECGGPTARETLSLLRSLQGLNLVGCDVVELNPSYDGPGQITALLGA
TVMAELLAILAEARVRERSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctgcccaccgactcgctctccaccccccgcttcgtcggcctgccgagcttc
atgcgcctgcccatggccacggagcttcaggggctcgacgccgcgatcgtcggcctgccc
tcggattcgggcgcgcccttccgcaccggcgcgcgcttcgcgccgaacgcgctgcgggcc
atgtcggtgatgctgcgcccgatcaacccctaccgcggccacatcaacatcttcgaggtc
ctgcgcgtggccgatgcgggcgacgcgacctgcgtgccgggctacgagatcgaaagcctc
gccgcgctcgaacgggcacttgatgcggtggtcgaggccggcgccgtgcccttcggcatc
gggggcgaccactcggtctcgcttgccggtctccgggcggtggccaagcgtcacgggccg
ctcggcctcgtgcatttcgacagccacaccgacacctgggacagctacttcgacggcaag
cgctacagcgccggcaccatgttccgccgggccatcgaggagggcatcgtcgaccccgcc
cgctcgatccaggtggggatgcgcggctcgctgttccagcgggccgatgtcagccagtcg
gtcgatctcggcctcgaggtcatcacctgcgacgagatgtttgcgctgggactgcccgag
accgcccgtcggatcgccgcgcgcagcgcgggccatccggccttcctgagcttcgatctc
gatttcgtggatcccgcctatgcgcccggcgtcgagacgcccgagtgcggcggccccacc
gcgcgcgagacgctctcgctgctgcgcagcctccagggcctcaacctcgtcggctgcgac
gtggtcgagctcaatccttcctatgacggtccgggccagatcaccgccctgctcggggcc
accgtcatggccgagcttctggcgatcctcgccgaggcgcgggtccgcgagcggtcacga
taa

DBGET integrated database retrieval system