KEGG   Rhodobacter sphaeroides KD131: RSKD131_4150Help
Entry
RSKD131_4150      CDS       T00844                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase precursor
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00520  Amino sugar and nucleotide sugar metabolism
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSKD131_4150
Enzymes [BR:rsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     RSKD131_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short KR UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACM04010
UniProt: B9KVD2
Position
2:1095948..1096979
Genome map
AA seq 343 aa AA seqDB search
MHEHKRILVTGGLGFLGSFLCESLLADGHEVICVDSFQTGSRENVAHLRDHPNFEIMRHD
VTVPLHVEADEIFNLACPASPIHYQVDPVKTVKTSVMGAINLLDLARRTKSKIFQASTSE
VYGDPKVHPQPEGYWGHVNPNGPRSCYDEGKRCAETLFFDYHRQYGVNIRIARIFNTYGP
RMHPNDGRVVSNFIVQALSGKPITIYGDGTQTRSFCYVTDLIRGFRALMDAPDGIELPVN
LGNPGEFTMLELATLVIELTGSRSKVVHLPLPKDDPTQRKPDITRATETLGWKPEIPLFD
GLQRTIAHFDQLLSRTQKRTVPEMSMAMVANGLARNGASEALR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaacacaagcgcattctggtgacgggcggtctcggcttcctcggctccttcctg
tgcgagagcctgcttgccgacggccatgaggtcatctgcgtcgacagcttccagaccggc
tcccgcgagaatgtggcccacctccgggaccatcccaacttcgagatcatgcgccacgac
gtgaccgtgccgctgcatgtcgaggccgacgagatcttcaacctcgcctgcccggcctcg
ccgatccactatcaggtcgatccggtgaagacggtgaagaccagcgtcatgggggcgatc
aacctgctcgacctcgcgcggcgcaccaagtcgaagatcttccaggcctcgacctccgag
gtctatggcgatcccaaggtccatccccagcccgaaggctactggggccatgtgaacccc
aacggcccgcgctcctgctacgacgagggcaagcgctgcgccgagaccctgttcttcgac
tatcaccgccaatatggcgtgaacatccgcatcgcccggatcttcaacacctacgggccg
cggatgcatccgaacgacgggcgggtggtctcgaacttcatcgtccaggcgctgagcggc
aagccgatcacgatctacggcgatggcacgcagacccgctccttctgctacgtcaccgac
ctgatccggggcttccgggccctgatggacgcgccggacgggatcgagctgccggtgaac
ctcggcaacccgggcgagttcaccatgctcgagctggcgacgctggtgatcgagctgacc
ggctcgcgctccaaggtcgtgcatctgccgctgccgaaggacgatcctacccagcgcaag
cccgacatcacccgcgccaccgagacgctcggctggaagcccgagatcccgctgttcgac
ggcctgcagcgcacgatcgcccatttcgaccagctgctgagccggacgcagaagcggacc
gtccccgagatgtcgatggcgatggtcgcgaacggtctcgcccgcaacggcgcctccgag
gcgctgcgctga

DBGET integrated database retrieval system