KEGG   Ralstonia solanacearum PSI07: RPSI07_0858Help
Entry
RPSI07_0858       CDS       T01273                                 

Definition
(GenBank) putative Nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RPSI07_0858
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     RPSI07_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CBJ50218
Position
complement(861753..862622)
Genome map
AA seq 289 aa AA seqDB search
MSTTTLTSAATASVPDAPFDAPFRVAAIQTVTGIGVDANLARADALLAEAAARGAQLALL
PEYFCMMGRKDSDKVGIREADQDGPIQAFLADAARRHRLWLVGGTLPLWCEDAERVRNTS
LAFDPAGQRVARYDKIHLFNFVRGEERYDEARTIEPGATPVAFEAPCGRVGMSVCYDLRF
PELYRALSAQGNLNLILMPAAFTYVTGAAHWEILLRARAVENQCYVLAAAQGGRHENGRR
TWGHSMLIDPWGEIIASVPEGEGVAIGDMDPARLAQVRRDLPALRHRVM
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccaccctcacctccgctgccaccgcgtccgtcccggatgcgccgttcgat
gcccccttccgcgtcgccgccatccagaccgtgacgggcatcggcgtggacgccaacctg
gcccgtgccgacgcgctgctcgccgaagccgcggcccggggcgcgcagctggcgctgctg
cccgagtatttctgcatgatgggccgcaaggacagcgacaaggtcggcatccgcgaggcg
gaccaggacggcccgatccaggccttcctggccgatgccgcgcgccggcaccggctgtgg
ctggtcggcggcacgctgccgctgtggtgcgaggatgccgagcgcgtgcgcaatacgtcg
ctcgcgttcgatccggccggccagcgcgtggcccgctacgacaagatccatctgttcaac
ttcgtgcgcggcgaagagcgctacgacgaagcgcgcaccatcgagccgggcgccacgccg
gttgcgttcgaggcgccgtgcggccgcgtcggcatgtcggtgtgctacgacctgcgcttc
ccggagctgtaccgggcgctgtcggcgcagggcaacctgaacctgatcctgatgccggcc
gccttcacctacgtgacgggcgcggcgcactgggaaatcctgctgcgcgcccgcgccgtc
gaaaaccagtgctacgtgctcgccgccgcacagggcggacgccacgagaacggccgccgc
acgtggggccactccatgctgatcgacccgtggggtgagatcatcgcctccgtgccggaa
ggcgaaggcgtggccatcggcgacatggacccggcgcgcctggcgcaggtccgccgcgac
ctgccggcactcaggcaccgcgtgatgtag

DBGET integrated database retrieval system