KEGG   Ralstonia solanacearum PSI07: RPSI07_1446Help
Entry
RPSI07_1446       CDS       T01273                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00260  Glycine, serine and threonine metabolism
rsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
rsl01230  Biosynthesis of amino acids
Module
rsl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_1446 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_1446 (trpB)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPSI07_1446 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ50807
UniProt: D8P1Q8
Position
1480666..1481859
Genome map
AA seq 397 aa AA seqDB search
MYNLPDAHGHFGPYGGTFVAETLTHALDELRDAYARYQHDPEFIKEYEYELKHFVGRPSP
IYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVADTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDHASVQLIGAEAAGEGIETDRHAASLTCGSPGVLHGNRTYLLQDEDGQIIET
HSISAGLDYPGVGPEHAWLKDAGRAQYVGITDQEALQAFHDLCRMEGIIPALESSHALAY
ACKLAPTLPKDKILLVNLSGRGDKDMHTVAEFSGIQL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctgcctgacgcccacggccacttcggaccctacggcggcaccttcgtcgca
gaaaccctgacccacgcgctggatgaactgcgcgacgcctatgcgcgctaccagcacgat
cccgagttcatcaaggaatacgagtacgagctgaagcatttcgtcggccgtccgtcgccc
atctaccatgcccgccgcctgaccgagcactgcggcggcgcgcagatctacctcaagcgc
gaagacctgaaccacaccggcgcccacaaggtgaacaacgtcatcggccaggcgctgctg
gcgcgccgcatgggcaagccgcgcgtgatcgccgaaaccggcgccggccagcacggcgtg
gccacggccaccatcgccgcgcgctacggcatggaatgcgtggtctacatgggcagcgag
gacgtgcgccgccaggccgccaacgtctatcgcatgaagctgctgggcgcgaccgtggtg
ccggtggaatccggttcgcgcacgctcaaggatgcgctcaacgaagcgatgcgcgactgg
gtgaccaacgtggccgacaccttctacatcatcggcaccgtggctgggccgcacccgtat
ccgatgatggtgcgcgacttccagtcggtgatcggcgaggagtgcaaggtgcagatgccc
gagctggccggtcgccagccggacgccgtgatcgcctgcgtgggcggcggctccaatgcc
atgggcatcttctatccgtacatcgatcacgccagtgtgcagctgatcggcgcggaagcg
gcgggcgagggcatcgagacggaccgccacgccgcgtcgctcacgtgcggttcgccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgaggacggccagatcatcgagacg
cattcgatctcggccggcctggactacccgggtgtcggccccgagcatgcctggttgaag
gatgccggccgcgcgcagtatgtcggcatcaccgaccaggaagcgctgcaggccttccac
gacctgtgccgcatggagggcatcatccccgcgctggaatcgagccatgcgctggcctac
gcctgcaagctggcgccgacgctgccgaaggacaagatcctgctggtcaacctgtccggc
cgcggcgacaaggacatgcataccgtcgccgaattctcgggcatccagctctga

DBGET integrated database retrieval system