KEGG   Ralstonia solanacearum PSI07: RPSI07_1478Help
Entry
RPSI07_1478       CDS       T01273                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl00680  Methane metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1478 (acsA)
   00620 Pyruvate metabolism
    RPSI07_1478 (acsA)
   00640 Propanoate metabolism
    RPSI07_1478 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RPSI07_1478 (acsA)
Enzymes [BR:rsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPSI07_1478 (acsA)
Lipid biosynthesis proteins [BR:rsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPSI07_1478 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBJ50838
UniProt: D8NSP7
Position
1507945..1509927
Genome map
AA seq 660 aa AA seqDB search
MAGIESVLQETRVFEPPASFVKQANIAGMDAYRALCAEAERDYEGFWARLAHEHLLWHKP
FSKVLDESNAPFYTWFEDGELNASYNCLERNLENGNADKVAIIFEADDGTVARVTYRELH
ARVCRFANGLKALGIQKGDRVVIYMPMSVEGVVAMQACARIGATHSVVFGGFSAKSLQER
IVDVGAIAVITADEQMRGGKALPLKAIADEALAMEGTEAVRHVVVYRRTGAGVNWVEGRD
RAMDEVEAGQPDTCEVTPVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLWALLTMQWTFD
LKHDDVFWCTADIGWVTGHTYIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIQKHKVNTF
YTAPTAIRSLIKAAEADEKIHPKQYDLSSLRLLGTVGEPINPEAWVWYHTNIGGGRCPIV
DTFWQTETGGHMISPLPGVTPLVPGSCTLPLPGIMAAIVDETGQDLPDGQGGILVVKRPW
PSMIRTIWGDPERFRKSYFPAELGGKLYLAGDGSVRDKETGYFTIMGRIDDVLNVSGHRM
GTMEIESALVANPLVAEAAVVGRPDDMTGEAICAFVVLKRTRPNGDEARRIATDLRNWVG
KEIGPIAKPRDIRFGDNLPKTRSGKIMRRLLRSIAKGEDITQDTSTLENPAILEQLKEAR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggctggcattgaatctgttctgcaggaaacgcgtgtcttcgagccgccggcgtccttc
gtcaaacaggccaacatcgccggcatggacgcctaccgcgcgctgtgcgccgaggccgag
cgcgactacgagggcttctgggcacgcctggcgcacgagcacctgctgtggcacaagccc
ttctccaaggtcctcgacgaatccaacgcgccgttctacacgtggttcgaggacggcgag
ctgaacgcctcgtacaactgcctcgaacgcaacctggaaaacggcaacgccgataaggtc
gccattattttcgaggccgacgatggcacggtcgcgcgcgtcacctaccgcgaactgcac
gctcgcgtgtgccgcttcgccaatggcttgaaggcgctgggcatccagaagggcgaccgc
gtagtgatctacatgccgatgtcggtcgagggcgttgtcgccatgcaggcctgcgcgcgc
atcggggcgacgcactcggtggtgttcggcgggttctcggccaagtcgctgcaggagcgg
atcgtcgacgtgggcgccatcgccgtcatcacggccgacgagcagatgcgcggcggcaag
gcgctgccgctcaaagccatcgccgatgaggcattggcgatggagggcaccgaggccgtc
cggcacgtggttgtctaccggcgtaccggcgccggcgtgaactgggtcgaaggccgcgac
cgcgccatggacgaggtcgaagccggccagcccgatacctgcgaagtgaccccggtcagt
gccgagcatccgctgttcatcctctacacctcgggctccaccggcaagcccaagggcgtg
cagcacagcaccggcggctacctgctgtgggcgctgctgacgatgcagtggaccttcgac
ctgaagcacgacgacgtcttctggtgcaccgccgacatcggctgggtcaccggccacacc
tatatcgcctatggtccgctcgccgccggcgccacccaggtggtgttcgaaggcgtgccg
acctaccccaatgccggccgcttctgggacatgatccagaagcacaaggtcaacacgttc
tacaccgcgccgacggcgatccgctcgctgatcaaggccgccgaggccgacgagaagatc
cacccgaagcagtacgacttgtccagcctgcgcctgctgggcaccgtgggcgagccgatc
aacccggaagcctgggtgtggtatcacacgaacatcggcggcggccgctgccccatcgtc
gataccttctggcagaccgagaccggcggccacatgatctcgccgctgccgggcgtcacg
ccgctggtgccgggctcgtgcacgctaccgctgccgggcatcatggccgccatcgtcgac
gagaccgggcaggacctgccggacgggcagggcggcatcctcgtcgtcaagcggccgtgg
ccgtcgatgatccgcaccatctggggcgatccggagcgcttccgcaagagctacttcccg
gccgagttgggcggcaagctctacctggccggcgacggctcggtgcgcgacaaggagacc
ggctacttcaccatcatgggccgcatcgacgacgtgctgaacgtctcgggccaccgcatg
ggcacgatggagatcgaatcggcgctggtggccaacccgctggtggccgaagccgccgtg
gtgggccgccccgacgacatgaccggcgaggccatctgcgccttcgtggtgctcaagcgc
acgcgcccgaacggggacgaggccaggcggatcgccaccgacctgcgcaactgggtcggc
aaggagatcggtccgatcgccaagccccgcgacatccgctttggcgacaacctgcccaag
acgcgttcgggcaagatcatgcggcgcctgctgcgctcgatcgccaagggcgaggacatc
acgcaggacacctccacgctcgagaacccggccatcctggagcagctcaaggaagcccgc
tga

DBGET integrated database retrieval system