KEGG   Ralstonia solanacearum PSI07: RPSI07_1725Help
Entry
RPSI07_1725       CDS       T01273                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase (beta-ketothiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00071  Fatty acid degradation
rsl00072  Synthesis and degradation of ketone bodies
rsl00280  Valine, leucine and isoleucine degradation
rsl00310  Lysine degradation
rsl00362  Benzoate degradation
rsl00380  Tryptophan metabolism
rsl00620  Pyruvate metabolism
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl00640  Propanoate metabolism
rsl00650  Butanoate metabolism
rsl00900  Terpenoid backbone biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01212  Fatty acid metabolism
rsl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_1725 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_1725 (phaA)
   00640 Propanoate metabolism
    RPSI07_1725 (phaA)
   00650 Butanoate metabolism
    RPSI07_1725 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_1725 (phaA)
   00072 Synthesis and degradation of ketone bodies
    RPSI07_1725 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_1725 (phaA)
   00310 Lysine degradation
    RPSI07_1725 (phaA)
   00380 Tryptophan metabolism
    RPSI07_1725 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPSI07_1725 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPSI07_1725 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPSI07_1725 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsl04147]
    RPSI07_1725 (phaA)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPSI07_1725 (phaA)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPSI07_1725 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBJ51087
UniProt: D8NTD3
Position
1742861..1744042
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAVRTAVGKFGGSLAKIPAQELGAAVIREALSRAKVAPDQVSEVIMGQVLTAG
SGQNPARQALIKAGLPDMVPGMTINKVCGSGLKAVMLAANAIVAGDADIVVAGGQENMSA
APHVLPGSRDGFRMGDTKLIDSMIVDGLWDVYNQYHMGITAENVAKQYGITREAQDAFAV
ASQNKAEAAQKSGRFNDEVVPILIPQRKGDPIAFTQDEFVRHGATLESMASLKPAFDKAG
TVTAANASGLNDGAAAVVVMSAARAKELGLTPLATIRAYANAGVDPKVMGMGPVPASKRC
LSRAGWSVGDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKKGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgttgtgatcgtatcggcggtccgtaccgccgtgggcaagtttggcggctcg
ctggcgaagatccccgcgcaggagctgggcgcggccgtgatccgcgaagcgctgtcgcgc
gccaaggtggcgccggaccaggtcagcgaagtcatcatgggccaggtgctgaccgcgggt
tccggccagaaccccgcgcgccaggcgttgatcaaggctggtctgcccgacatggtgccg
ggcatgaccatcaacaaggtgtgcggttcgggcctgaaggccgtgatgctggccgccaat
gcgatcgtcgccggggatgccgacatcgtcgtggccggcgggcaggagaacatgtccgcc
gcgccgcacgtgctgcccggctcgcgcgacggcttccgcatgggcgacaccaagctcatc
gattcgatgattgtggacgggctgtgggacgtctacaaccagtaccacatgggcatcacc
gccgagaacgtcgccaagcagtacggcatcacgcgcgaggcccaggacgcattcgccgtg
gcctcgcagaacaaggcggaagccgcgcagaagtccggtcgcttcaatgacgaggtcgtc
cccatcctgattccgcagcgcaagggcgacccgatcgccttcacgcaggacgagttcgtc
cgccatggcgccacgctggagtcgatggcgagcctgaagcccgcgttcgacaaagccggt
acggtgacggccgccaacgcctcgggcctcaatgacggcgccgccgccgtggtggtcatg
tccgccgcccgcgccaaggaactgggcctgaccccgctggccaccatccgcgcctacgcc
aatgccggcgtggacccgaaggtgatgggcatgggcccggtgccggcctccaagcgctgt
ctgtcgcgcgccggctggtcggtcggtgacctggacctgatggagatcaacgaggcgttt
gccgcccaggcgctggccgtgcatcagcagatgggctgggatacctccaaggtcaacgtc
aatggcggcgcgatcgccatcggccatccgatcggcgcgtcgggctgccgcatcctggtg
acgctgctgcacgaaatgcagaagcgcgatgcgaagaagggcctggcctcgctgtgtatc
ggcggcggcatgggcgtggcgctggcggtcgagcgcccgtga

DBGET integrated database retrieval system