KEGG   Ralstonia solanacearum PSI07: RPSI07_1880Help
Entry
RPSI07_1880       CDS       T01273                                 

Gene name
bioF
Definition
(GenBank) 7-keto-8-aminopelargonic acid synthetase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00780  Biotin metabolism
rsl01100  Metabolic pathways
Module
rsl_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RPSI07_1880 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsl01007]
    RPSI07_1880 (bioF)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     RPSI07_1880 (bioF)
Amino acid related enzymes [BR:rsl01007]
 Aminotransferase (transaminase)
  Class II
   RPSI07_1880 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CBJ51243
Position
complement(1948502..1949788)
Genome map
AA seq 428 aa AA seqDB search
MRKPPAHTKEKPMRLLDDLRAGLAAIDAAHLRRVRRTAYSPTDRSQRIDVPGGEPRDILG
FCGNDYLGLAAHPALAQAVSEGARRYGFGSGASHLVSGHSVAHARLEGRMAALQAPHIPH
ADALFFCTGYMANMAVVSAMAQAGGISPAQDCTIFSDALNHASLIDGARLSRAAVTVYPH
VDLAALEAQLAASTSRNKLIVTDGVFSMDGDIAPLPELLALAERFDAWLIVDDAHGLGVL
GVDGAGVLSHFGLHSERLVYVGTFGKAAGAAGACVVAHRMVVDWLVQRARTYIFTTATPP
AVACGVEAALDLIAGAEGAARRARLAGHIARWSDHAQRLAARFGWQWMPSPTAIQPLVIG
ENAPALALAAALEREGIRIAAIRPPTVPAGTARLRITLSAAHTDDDIERLARALEAAGQS
QQSAARAA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaagccaccggcgcacacgaaggagaaacccatgcgattgcttgacgacctgcgg
gccggcctggccgccatcgacgccgcgcacctgcgccgcgtgcgccgcaccgcctacagc
ccgaccgaccgcagccagcgcatcgacgtgccgggcggcgagccgcgcgacatcctcggc
ttctgcggcaacgactacctcggcctggccgcgcatccggcgctggcgcaggcggtgagc
gagggcgcccgccggtacggtttcggcagcggcgcctcgcacctcgtcagcggccactcg
gtggcacatgcgcgactggaggggcgcatggcggccctgcaggcgccgcacattccccac
gccgatgcgttgttcttctgcaccggctacatggccaacatggcggtggtcagcgcgatg
gcgcaggccggcggcatcagccccgcgcaagactgcacgattttctccgacgcgctgaac
catgcctcgctgatcgatggcgcccggctgtcgcgcgcggccgtcacggtctatccgcac
gtcgacctggccgcactggaggcgcaactggccgccagcaccagccgcaacaagctgatc
gtcaccgacggcgtgttcagcatggacggcgacatcgcgccgctgcccgaactgctggcg
ctggccgagcgcttcgatgcctggctgatcgtcgacgacgcgcacggcctgggcgtgctc
ggcgtggacggggcgggggtgctgtcgcactttgggctgcactccgagcgccttgtctat
gtcggcaccttcggcaaggcggccggcgccgccggagcctgcgtggtggcgcaccggatg
gtggtcgactggctggtgcagcgggcccgcacgtatatcttcacgaccgccaccccgccc
gccgtcgcctgcggggtcgaggcagcactggacctgatcgccggggcggagggcgccgcg
cgccgggcccggctggccggccacatcgcccgctggagcgatcatgcgcagcggctggcg
gcacgtttcggctggcagtggatgccgtctcccaccgccatccagccgctggtgatcggc
gagaacgcgccggcgctggcgctggcggcggcgctggagcgcgagggcatccgcatcgcc
gcgatccgcccgccgaccgtgccggccgggaccgcgcggctgcgcatcacgctgtcggcc
gcgcacaccgatgacgacatcgagcggctggcccgcgcgctggaggcggccggccaatcg
cagcaatccgccgcccgcgctgcctga

DBGET integrated database retrieval system