KEGG   Ralstonia solanacearum PSI07: RPSI07_2008Help
Entry
RPSI07_2008       CDS       T01273                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Module
rsl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_2008 (aceA)
Enzymes [BR:rsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RPSI07_2008 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CBJ51372
UniProt: D8NU52
Position
complement(2095170..2096474)
Genome map
AA seq 434 aa AA seqDB search
MSRELEVKTLQQEWDTNPRWKGIKRGYTAEDVVRLRGSLQIEHTLARRGAEKLWSLMNNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANSNGEMYPDQSLYSVDSVPKVVKR
INNTFQRADQIQWSEGKDDIDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGVHFEDQ
LAAVKKCGHMGGKVLVPTREAVAKLVAARLAADVMGVPTVLIARTDAEAADLLTADVDDN
DRPFCTGERTVEGFYRTKPGLQQAISRGLAYAEYADLVWCETGKPDLEYAKKFAEAIHAK
FPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHG
YARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIEREASTTALKGSTED
EQFFEEKAEAKKVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgaactcgaagtgaagacgctgcagcaagagtgggacaccaacccgcgctgg
aagggcatcaagcgtggctacaccgcggaagacgtggtgcgcctgcgcggctcgctgcag
atcgagcacaccttggcccgccgcggtgccgaaaagctgtggagcctgatgaacaacgag
ccgttcgtcaacgcgctgggcgcgctgacgggcaaccaggccatgcagcaggtcaaggct
ggcctgaaggcgatctatctgtcgggctggcaagtcgccggtgacgccaacagcaacggc
gagatgtatcccgaccagtcgctgtactcggtggactcggtgcccaaggtcgtcaagcgc
atcaacaacacgttccagcgcgccgaccagatccagtggtcggaaggcaaggacgacatc
gatttcttcgccccgatcgtggcggatgccgaagccggcttcggcggcgtgctgaacgcg
ttcgagctgatgaaggcgatgatcgaagcgggcgcttcgggcgtgcacttcgaagaccag
ctggcggccgtcaagaagtgcggccacatggggggcaaggtgctggtgccgacgcgtgag
gcggtggccaagctggtggccgcgcgcctggccgccgacgtgatgggcgtgccgaccgtg
ctgatcgcccgcaccgatgccgaggccgccgacctgctgaccgccgacgtggacgacaac
gaccgcccgttctgcaccggcgagcgtaccgtggaaggcttctaccgcaccaagccgggc
ctgcagcaagccatctcgcgcggcctggcctacgccgaatacgccgacctggtgtggtgc
gaaaccggcaagccggacctggagtacgccaagaagtttgccgaggcgatccatgccaag
ttccccggcaagatgctggcctacaactgctcgccgtcgttcaactggaagaagaacctg
gacgacgccaccatcgccaagttccagaaggaactgggcgcgatgggctacaagttccag
ttcatcacgctggccggcttccacgccctgaactactcgatgttcaacctggcccacggc
tatgcccgcaaccagatgagcgccttcgtcgagctgcaggaagccgaattcgcggcggcc
gagaagggcttcaccgcagtcaagcaccagcgtgaagtcggcaccggctacttcgatgcc
gtgacgcagaccatcgagcgcgaagcgtccaccacggcgctcaagggctcgaccgaggac
gaacagttcttcgaagaaaaggcggaagccaagaaggttgcttga

DBGET integrated database retrieval system