KEGG   Ralstonia solanacearum PSI07: RPSI07_2095Help
Entry
RPSI07_2095       CDS       T01273                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00310  Lysine degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_2095 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RPSI07_2095 (sucB)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPSI07_2095 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBJ51460
UniProt: D8NUD7
Position
complement(2189654..2190916)
Genome map
AA seq 420 aa AA seqDB search
MAIVDVKVPQFSESVEEGTLISWKKKPGEAVAVDEVLVEIETDKVVLEVPAPSAGVLAEV
LVADGATVASEQLLAKIDTEGKAGAAATAAVASAPAAAAPAPVAAAPASAAAAATGGVAM
PSAAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQVAAP
VDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFE
KTHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSLADIEKKIAEFGVKARDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgatgtcaaggtcccgcagttttccgaatccgtcgaagaaggcacgctg
atctcctggaagaagaagccgggtgaagccgtggccgtggacgaagtcctggtcgaaatc
gagaccgacaaggtcgtgctggaagtgccggccccgtcggctggcgtgctggctgaagtg
ctggtggccgacggcgccaccgtggcgtcggaacagttgctggccaagatcgacaccgaa
ggcaaggcgggcgctgctgccacggctgccgttgcatcggctccggccgctgccgcgccc
gcaccggtcgctgctgcgccggcctcggctgccgctgccgccaccggtggcgtggccatg
ccgtcggctgccaagctgatggccgaagccaacctgtcggctggccaagtggccggcacg
ggccgcgatggccgcatcaccaagggcgacgtgctgggtgccgtggccggcggtgccaag
ccggctccggccgccgcaccgcaggccgcgcgtccggccctgcagcaagtggctgcgccg
gtggacttcgccgccctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgc
gcccgcatcgccgagcgcctggtgcagtcgcagtcgaccaacgccatcctcaccaccttc
aatgaagtcaacatgaagccggtgatggacttgcgcgccaagttcaaggaccagttcgag
aagacccacggcgtgaagctgggcttcatgtcgttcttcgtgaaggccgccgtccacgcg
ctgaagaagtacccggtcatcaacgcctcggtggatggcaacgacatcgtctaccacggc
tacttcgacatcggtatcgccgtcggctcgccgcgcggcctggtggtgcccatcctgcgc
aatgccgaccagatgagcctggccgacatcgagaagaagatcgctgaattcggcgtcaag
gcccgcgacggcaagctgacgctggacgacctgaccggcggcacgttctcgatctccaac
ggcggtaccttcggttcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatc
ctgggcgtgcacgcgaccaaggaccgcgccgtggtggagaacggccaagtcgtggtccgc
ccgatgaactacctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgtg
ctgggcctggtggcgatgaaggaagcgctggaagacccggcccgcctgctgctggacctg
taa

DBGET integrated database retrieval system