KEGG   Ralstonia solanacearum PSI07: RPSI07_2652Help
Entry
RPSI07_2652       CDS       T01273                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPSI07_2652 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS Methyltransf_23 Methyltransf_12 RrnaAD PrmA tRNA_U5-meth_tr NodS Ubie_methyltran Methyltransf_32 Methyltransf_18 Met_10 ADH_zinc_N Cons_hypoth95 Methyltr_RsmB-F Methyltransf_4 TehB UPF0146 CMAS Methyltransf_16 DUF938 TPMT GCD14
Motif
Other DBs
NCBI-ProteinID: CBJ52018
UniProt: D8NXI5
Position
2781130..2781870
Genome map
AA seq 246 aa AA seqDB search
MTIRAGMSSGLAKISGLSTNPHSLRLEGMPMDIEKSRFNMIEQQIRPWDVLDLDVLDLLA
IVKREQYVPEAYRALAFVDMEIPLPGGQNMLPPRVEARVLQELAVRKHEDVLEVGAGSGY
MAALLAHRGRHVTTVDIASELVAFARDNLARNGVTNVDVAEGDAAQGWGNSLYDVICVSG
SVPAVPESLLMQLKVGGRLSIFVGSAPVMEAQLITRVSETEFQTRNLFETYVTPLAGVPA
PSQFRF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgcgccggaatgtcctccggacttgctaaaatatcgggtttgtcgacaaac
cctcattcgctccgcctggaaggcatgcccatggacatcgaaaaatcccggttcaacatg
atcgagcagcagatccgcccatgggatgtgctcgatctcgacgtgctcgacctgctggcc
atcgtcaagcgcgagcaatatgtgcccgaggcttaccgcgcgctggccttcgtcgacatg
gaaattccgctgcccggcggccagaacatgctgcccccgcgcgtggaagcccgcgtgctg
caggaactggccgtgcgcaagcacgaagacgtgctcgaagtgggcgcgggctcgggctac
atggccgcgctgctggcccaccgtggccgccacgtcaccaccgtggacatcgcatccgaa
ctggttgccttcgcgcgcgacaacctcgcccgtaacggcgtgaccaacgtcgacgtggcc
gagggcgatgccgcccagggctggggcaacagcctgtacgacgtcatctgcgtgtcgggt
tcggtgccggcggtgccggaatccctgctcatgcagctgaaggtcggcggccgcctgtcg
atcttcgtgggcagtgcgccggtcatggaggcgcagctgatcacgcgcgtctccgagacc
gaattccagacacgcaacctgttcgaaacctatgtgacgccgctggcgggtgtgcccgcg
ccgtcgcagttccgcttctaa

DBGET integrated database retrieval system