KEGG   Ralstonia solanacearum PSI07: RPSI07_2931Help
Entry
RPSI07_2931       CDS       T01273                                 

Definition
(GenBank) lipase/esterase protein (bah)
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00903  Limonene and pinene degradation
rsl00930  Caprolactam degradation
rsl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_2931
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RPSI07_2931
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     RPSI07_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Esterase_phd AXE1
Motif
Other DBs
NCBI-ProteinID: CBJ52294
Position
complement(3066735..3067688)
Genome map
AA seq 317 aa AA seqDB search
MSWQNWVVSWLARNRIKRPTERLPFDPIATRVNAETRSMPMPVRLPPDWRIVRADGALPG
EWIEPADPDRLGDAPPVVFYLHGGGYFFCSPRTHRSITIGLAVHARARVFALDYRLAPEH
PFPAAVLDALAGYRGLLAQRVAPSRIVVAGDSAGGGLSLALLVALRDAGDPLPAGAILYS
PWTDLAATGASLVENDASDVMFRGAWMAPGAALYLGDSGVPVDHPLVSPLYADFTGLPPL
HCYVSTSEVLRDDTLRMAERARAAGVSVSVELGRRLPHVWPIFYPFLPEARTALRQSGDA
VRRMTADRTVPEAFAPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagaactgggtggtgtcgtggctggcgcgcaaccgcatcaagaggccgacg
gagcggctgccgttcgacccgatcgcgacgcgcgtcaatgcggagacgcgatcgatgccg
atgccggtgcgcctgccgccggactggcgcatcgtccgggccgatggcgccctgcccggc
gaatggattgagccggccgatcccgacaggctcggcgatgcgccaccggtagtgttctat
ctgcacggcggcggctacttcttctgcagcccgcgcacgcatcgttccatcaccatcggc
ctggccgtgcatgcacgggcgcgcgtgttcgcgctggactaccgcctggcgcccgagcat
ccttttcccgcagccgtgctggacgcgctggccggctatcgtggcttgctggcgcagcgg
gtcgcgccatcgcgcatcgtggtggcgggggattcggcgggcggcgggctgtcgctggcg
ctgctggtggccctgcgcgatgccggcgatccgctgccggccggcgcgatcctgtattcg
ccgtggaccgatctggctgccaccggcgccagcctggtcgagaacgacgcctccgacgtg
atgttccgcggtgcctggatggcgcccggcgcggcgctctatctgggcgactccggcgtg
ccggtcgaccatccgctggtctcgccgctgtacgccgatttcaccgggctgccgcccctg
cactgctacgtcagcaccagcgaagtgctgcgcgacgacaccctccggatggcggagcgc
gcgcgggccgcgggggtatccgtttcggtggaattgggacgcaggctcccacacgtgtgg
ccgatcttctatcctttcttaccagaggcgcgcacagcgctgcggcagtccggcgacgcg
gtgcgtcgcatgacagcggaccgcacggtgccggaagcattcgcgccggcatga

DBGET integrated database retrieval system