KEGG   Ralstonia solanacearum PSI07: RPSI07_3011Help
Entry
RPSI07_3011       CDS       T01273                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00900  Terpenoid backbone biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPSI07_3011 (ispE)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RPSI07_3011 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBJ52366
UniProt: D8NZ82
Position
3147211..3148080
Genome map
AA seq 289 aa AA seqDB search
MSSAPTELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWCDTLHFGRRIDGRLVRT
TDVPGVPADEDLVIRAARLLQAETGCTYGADIALEKHLPMGGGIGGGSSDAATTLLVLNR
LWGLDLPRTKLMSLGLRLGADVPFFLFGQNAFAEGIGEELTPITLPPATFVVIHPRVHVP
TPEIFSDDGLTRDTPRTIITDFPDRQIVFAYGRNDLQAVAERKYGEIARALAWLRQFSPL
ARMTGSGACVFAPFDRAEQAQAVVDQVPSEWEGRCAAGLAHHPLAMFAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcgcccaccgaactgcgcgactgccccgcgcccgccaagctcaacttgttc
ctgcacgtggtcggccgccgaccggacggctaccacctgctgcagaccgtgttccagctg
atcgactggtgcgacacgctgcacttcggccgccgtatcgatggccgcctggtgcgcacc
accgacgtacccggcgttccggcggatgaagacctggtcatccgcgccgcacgcctgctg
caggcggagactggctgtacctacggcgccgacatcgcactggaaaagcacctgccgatg
ggcggcggcatcggcggcggctcatccgatgcggcgactacgctactggtgctcaaccgc
ctgtggggactcgatctgccgcgcacgaagctgatgtcgctgggcctgcgcctcggcgcc
gacgtgcccttcttcctgttcggccagaacgcatttgccgagggcatcggtgaagaactg
acacccatcacgctgccgccggcgacgtttgtggtcatccacccacgggtccatgtcccc
acacccgaaattttttccgatgatgggttgacacgtgacactccccgcaccataattacg
gactttcctgaccgacaaattgttttcgcttacggtcgcaacgatttgcaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagctcttgcctggctgcgtcaattcagccccctg
gcaaggatgaccggatccggcgcctgcgtgttcgcaccgtttgatcgtgcggaacaggca
caagcggtggtggatcaggtaccttccgaatgggaaggtcggtgtgcggcaggtctggcg
catcacccgctcgcgatgtttgctgtgtaa

DBGET integrated database retrieval system